CAZyme Information: MGYG000000221_00655

Basic Information

• Species: Parabacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000221_00655
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000000221_2|CGC1	28410.39	8.0158

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000221	3481201	Isolate	China	Asia

• Gene Location: Start: 47915; End: 48673 Strand: -

Full Sequence      

MALCLLLSVTVYAGDKTSFLKKQFTTSNGYKLNYRVLYPENYCPDQQYPVILFLHGAGER
GDDNEAQLFHGGDMFASHTNRSKYPAIIIAPQCPKDISWSSYRKPEKDGEKRYYPSVAPI
TKPMAAVKELLDSYIAKGIVDTKRIYITGLSMGGMGTFDLVCRYPNLFATATPICGGANL
QRLANFKGKTVFSIYHGADDSVVNVQFSRDAYKTLKEAGIDVRYKEYPGVDHNSWDNAFA
EPDYLEWMFLHK

Enzyme Prediction     

No EC number prediction in MGYG000000221_00655.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	28	233	8.9e-33	0.8986784140969163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	1.15e-44	17	249	158	383	Predicted peptidase [General function prediction only].
COG1506	DAP2	1.57e-13	21	232	367	594	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG0400	YpfH	2.02e-12	38	229	7	186	Predicted esterase [General function prediction only].
pfam02230	Abhydrolase_2	1.16e-11	38	235	3	202	Phospholipase/Carboxylesterase. This family consists of both phospholipases and carboxylesterases with broad substrate specificity, and is structurally related to alpha/beta hydrolases pfam00561.
COG0412	DLH	3.86e-08	88	244	57	214	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61582.1	8.58e-44	34	249	827	1039
ABS60377.1	1.93e-41	31	252	21	244
QDU56037.1	1.54e-31	8	252	775	1006
VTR91196.1	1.09e-29	31	252	42	238
QJW99051.1	2.75e-29	31	252	43	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	7.85e-47	29	249	155	376	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	1.92e-21	29	252	18	216	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
6AVW_A	1.30e-10	51	233	8	195	Crystalstructure of Arabidopsis thaliana SOBER1 L63A [Arabidopsis thaliana]
6AVV_A	1.78e-10	51	233	8	195	Crystalstructure of Arabidopsis thaliana SOBER1 [Arabidopsis thaliana]
6AVX_A	1.78e-10	51	233	8	195	Crystalstructure of Arabidopsis thaliana SOBER1 F65L [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q84WK4	9.52e-10	51	233	6	193	Carboxylesterase SOBER1 OS=Arabidopsis thaliana OX=3702 GN=SOBER1 PE=1 SV=1
B8YG19	6.08e-07	121	235	122	244	Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum OX=4758 GN=xynS20E PE=1 SV=1
Q9HFJ5	4.31e-06	51	234	22	216	Acyl-protein thioesterase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=B2J23.070 PE=3 SV=2
P52090	7.03e-06	126	177	129	180	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000382	0.998971	0.000154	0.000176	0.000151	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000221_00655.