CAZyme Information: MGYG000000221_00761

Basic Information

• Species: Parabacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000221_00761
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000000221_2|CGC3	40966.14	7.503

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000221	3481201	Isolate	China	Asia

• Gene Location: Start: 176905; End: 177969 Strand: +

Full Sequence      

MKKPIKHILIIRFRRVGDSVLAVPLCTSLKKSFPDVQIDFVLNSAIASLYEGHPDIDKII
SFTDEENHSLIKYLSRVRQVMQATKYDVIIDMRSTVKTLFFSLFSLNTPYRIGTKKGYNV
LLHNYCIDNHNDNLTDMVQHNLQLLRPLEKEAKITYDPELRLYVDEKEKNSFRLYMEKQG
VDFSRPVIFASVVTRVAEKMWNPERMKDVLRRIIDKYQPQIIFNYTGNREEELAKALHKE
LDNDPHIFTSVRADSLLDLRAMIANCDFFFGNEGGPRHIAQSFGIPSYAIFSPGIVKSVW
LPGDKERYQGISPDDLSSPTQQGQMSAQDYFNLITVDDVWKEVDLMLNVYLAKK

Enzyme Prediction     

No EC number prediction in MGYG000000221_00761.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	78	314	4.3e-33	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	8.33e-50	5	348	1	331	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	5.42e-42	7	344	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.08e-14	76	293	3	211	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	9.56e-14	1	347	1	343	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR51520.1	1.53e-142	5	353	7	353
BAR48400.1	1.53e-142	5	353	7	353
AEW22458.1	1.53e-142	5	353	7	353
AVV52897.1	2.76e-134	9	352	13	354
AOH41188.1	2.76e-134	9	352	13	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	4.08e-12	6	293	9	289	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	1.33e-08	17	347	5	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	1.84e-06	17	347	5	331	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000221_00761.