CAZyme Information: MGYG000000221_00762

Basic Information

• Species: Parabacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000221_00762
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000000221_2|CGC3	39642.16	9.2507

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000221	3481201	Isolate	China	Asia

• Gene Location: Start: 177976; End: 179031 Strand: +

Full Sequence      

MAKILVIRLSAIGDVAMTVPVIYSAARSNPQDTFTVLTQAFLMPIFMNRPANVNVIGINT
KASEKTLRGLLKFASALVKYDFDIVLDLHDVIRSMIVRTLFRIKGKPVYVLDKARKERAR
LTDQKNKDLRPLRPVIERYADVFRSAGLNYVESFTSLYESKPADLSRMESIAGVKNGKWI
GIAPFAKHQGKIYPIESMEQVVAGLVEREDITVFLFGAKGYEEAVLEDWAYQYPRVKNVV
GRYALNDELALISQLDLLVCMDSANMHFASLVGTRVLSIWGATHPYTGFYGYRQQKEDTV
QLDLSCRPCSIFGDKSCFRGDWACMASMKPETILSKIYSILGIEYPYKVEK

Enzyme Prediction     

No EC number prediction in MGYG000000221_00762.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	72	318	1.4e-39	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.24e-51	3	337	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.01e-46	1	341	1	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	7.00e-23	71	309	2	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	1.97e-12	3	283	7	291	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX64806.1	3.44e-185	1	342	1	342
QRO15335.1	1.99e-184	1	342	1	342
QCY57932.1	1.99e-184	1	342	1	342
BBK92817.1	1.99e-184	1	342	1	342
ABR44532.1	1.99e-184	1	342	1	342

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	2.33e-08	13	283	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P25742	1.80e-07	13	283	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q57336	1.03e-06	6	285	13	286	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999593	0.000435	0.000008	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000221_00762.