CAZyme Information: MGYG000000221_02229

Basic Information

• Species: Parabacteroides bouchesdurhonensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides bouchesdurhonensis
• CAZyme ID: MGYG000000221_02229
• CAZy Family: GH109
• CAZyme Description: Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472	MGYG000000221_9|CGC2	52166.18	6.9919

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000221	3481201	Isolate	China	Asia

• Gene Location: Start: 81062; End: 82480 Strand: +

Full Sequence      

MKKENSISRRSFLKSSAMAGALGAIGTGSAASVLTSCDGGKKANALKPLKEPGTYYIPEL
PDLASDGKEIKAGVIGCGGRGSGATFNFLNAANGVTIVALGDTFQDRVDGLADKLKKEKN
IDIPADKRFVGLDAYKQVIDSGVDVVIVATPPVFRPVHFQYAVEKNKHAFLEKPICVDPA
GYRTIMATAKQAAAKNLCVVTGTQRHHQRNYVESYKKIMEGMIGEITGGCVYWNQNMLWY
RDRQPGWSDCEYMIKDWVNWKWLSGDHIVEQHVHNIDVFTWFSGLKPVKAVGFGSRQRRI
TGDQFDNFSIDFTMENGIHLHSMSRQIDGCANNVSEFIQGTKGSWSTANNETVIKDLAGN
VIWKYEPETRKEKNENGEEVAVEIYQQNDPYTLEHVNWINCIRKNTPIEQASETAVSNMA
AIMGRESAYTGAEVTWDAMTASPLDYTPKDLNLGKMDMSGFVVPVPGKPLDK

Enzyme Prediction     

EC	3.2.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	68	232	8.4e-17	0.40100250626566414

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.63e-37	67	434	1	338	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.50e-09	70	192	1	112	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
pfam10518	TAT_signal	4.13e-05	6	31	1	26	TAT (twin-arginine translocation) pathway signal sequence.
TIGR01299	synapt_SV2	0.002	281	319	467	506	synaptic vesicle protein SV2. This model describes a tightly conserved subfamily of the larger family of sugar (and other) transporters described by pfam00083. Members of this subfamily include closely related forms SV2A and SV2B of synaptic vesicle protein from vertebrates and a more distantly related homolog (below trusted cutoff) from Drosophila melanogaster. Members are predicted to have two sets of six transmembrane helices.
TIGR01409	TAT_signal_seq	0.002	7	27	1	21	Tat (twin-arginine translocation) pathway signal sequence. Proteins assembled with various cofactors or by means of cytosolic molecular chaperones are poor candidates for translocation across the bacterial inner membrane by the standard general secretory (Sec) pathway. This model describes a family of predicted long, non-Sec signal sequences and signal-anchor sequences (uncleaved signal sequences). All contain an absolutely conserved pair of arginine residues, in a motif approximated by (S/T)-R-R-X-F-L-K, followed by a membrane-spanning hydrophobic region. Members with small amino acid side chains at the -1 and -3 positions from the C-terminus of the model should be predicted to be cleaved as are Sec pathway signal sequences. Members are almost exclusively bacterial, although archaeal sequences are also found. A large fraction of the members of this family may have bound redox-active cofactors. [Protein fate, Protein and peptide secretion and trafficking]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK93797.1	2.11e-304	1	472	1	459
QIX65768.1	2.11e-304	1	472	1	459
QUT96603.1	2.11e-304	1	472	1	459
AST52349.1	2.11e-304	1	472	1	459
QUT20197.1	2.11e-304	1	472	1	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CEA_A	7.69e-08	68	295	7	210	ChainA, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_B Chain B, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_C Chain C, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1],3CEA_D Chain D, Myo-inositol 2-dehydrogenase [Lactiplantibacillus plantarum WCFS1]
3EC7_A	1.83e-06	62	225	16	168	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8H2K3	1.74e-06	7	239	3	217	Glycosyl hydrolase family 109 protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) OX=398579 GN=Spea_1465 PE=3 SV=1
Q01S58	2.96e-06	8	256	5	229	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1
Q8ECL7	7.12e-06	5	239	2	219	Alpha-N-acetylgalactosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagA PE=3 SV=1
A4FDY3	9.37e-06	70	274	3	195	Inositol 2-dehydrogenase 1 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=iolG1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as TAT

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000000	0.000000	0.988712	0.011288	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000221_02229.