CAZyme Information: MGYG000000222_00073

Basic Information

• Species: Parabacteroides sp003473295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003473295
• CAZyme ID: MGYG000000222_00073
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
623	MGYG000000222_1|CGC2	70631.46	6.075

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000222	4189286	Isolate	China	Asia

• Gene Location: Start: 97366; End: 99237 Strand: -

Full Sequence      

MNAASVVKGLSIIFFCSCILSGTAQNNSTSSVKHVKISGYIGNRIDDCIEHRVKAQDVEH
LVEPFRHHEEKNLWQSEFWGKWIQGAIASYRYNQDAELYKIISDAAESLMATQQENGYIG
NYAPEYQLQQWDIWGRKYTSLGLIAWYDLSGDKKALDAACRVIDHLMTQVGPQKVNIVTT
GNYVGMPSSSILEPVMYLYNRTKEQRYLDFANYIAEQWETPEGPQLISKAIADIPVANRF
PHPESWFSRENGQKAYEMMSCYEGLLELYKVTGNPLYLTVVEKTVGHIIREEINIAGSGS
AFECWYGGHDRQTQPTYHTMETCVTFTWMQLCNRLLQMTGNSLYADYMEKTIYNALMASL
KADASQIAKYSPLEGWRHEGEEQCGMHINCCNANGPRAFAMIPQFAYQVKEARINVNFYA
PSEAEIVLPGKKEISLKQLTDYPATDKIELEVSPVKETVCTIALRIPAWSTIAEVTINGQ
AEKGVLQGCYFPVTRKWKKGDKITLQLDLRARLIEQNQAQAIVRGPLVLARDSRFNDGFV
DETSVIVSKDGFVELTPVEVPAFAWLAFTAPMILGTDLEGDRTPRQIHFCDFASAGNTWD
KLQRYRVWLPKTLNVMNSPYKPY

Enzyme Prediction     

No EC number prediction in MGYG000000222_00073.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	68	529	1.9e-63	0.9103053435114504

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.55e-65	52	530	42	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.02e-65	24	609	6	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	1.27e-236	28	623	20	620
AGB41651.1	3.31e-42	81	554	76	584
ADH61394.1	4.55e-42	32	536	14	565
SNY90695.1	2.08e-41	31	580	23	601
QOY86860.1	5.48e-41	81	528	97	547

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	8.66e-33	81	536	74	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	2.27e-28	47	528	40	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	3.96e-26	47	528	40	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.76e-23	81	533	105	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
6YQH_AAA	4.32e-21	321	530	337	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.91e-18	81	538	80	574	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000244	0.999147	0.000182	0.000143	0.000135	0.000123

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000222_00073.