CAZyme Information: MGYG000000222_01011

Basic Information

• Species: Parabacteroides sp003473295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003473295
• CAZyme ID: MGYG000000222_01011
• CAZy Family: GH16
• CAZyme Description: Arylsulfatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518		58162.9	7.7763

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000222	4189286	Isolate	China	Asia

• Gene Location: Start: 79218; End: 80774 Strand: +

Full Sequence      

MNTKLFLSLAILPLATPLQGKEVAGQENTTRQTRPNIILFLVDDMGWQDTSLPFWKEKTH
YNEVYETPNMERLAKRGMMFTQAYASSISSPSRCSLFTGMNAARHRVTNWTYPKNASTDR
KSEVLTLPDWNVNGICQVSGIAHTYQATSLAQLLKNGGYHTIHCGKAHFGAVDTPGENPY
HMGFEVNIAGHAGGGLASYLGEANFGNRTDGKPNPWFAVPGLEKYWGKDIFISEALTQEA
VQALDKARRYDQPFFLYMAHYAIHVPIDKDKRFYQKYRDKGLTEKEAAYAALIEGMDKSL
GDLMDYLDKYRLTDNTIILFMSDNGGLSSEAGWRDGVLHTQNSPLNSGKGSAYEGGIREP
MIVSWPGHVQPGSKCDSYLIIEDFYPTLLEMAGIRHYKTVQPIDGISFMPLLEGKDSSSK
GRSLYWNFPNLWGNTGPGIGATCSVRDGDWKLIYYYETGKKELFNIKEDIGETHDRTESH
PALVKRLSKKLGKYLRKVEAQRPSFKATGRPCPWPDEL

Enzyme Prediction     

No EC number prediction in MGYG000000222_01011.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16144	ARS_like	1.18e-174	35	494	1	421	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16146	ARS_like	2.88e-94	35	499	1	409	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16145	ARS_like	4.52e-90	35	481	1	415	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16025	PAS_like	5.46e-79	33	475	1	401	Bacterial Arylsulfatase of Pseudomonas aeruginosa and related proteins. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	5.77e-74	34	475	1	397	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAR02039.1	4.27e-192	32	518	26	511
QUT89376.1	6.90e-187	28	516	17	498
ALJ59588.1	2.76e-186	28	516	17	498
AKJ65363.1	2.24e-77	31	504	23	453
QNN23223.1	1.02e-46	23	507	21	439

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6USS_A	6.29e-315	1	518	1	517	ChainA, Sulfatase [Bacteroides fragilis CAG:558],6USS_B Chain B, Sulfatase [Bacteroides fragilis CAG:558]
6UST_A	1.34e-80	34	503	4	461	ChainA, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_B Chain B, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_C Chain C, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_D Chain D, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi]
7STT_A	4.45e-62	34	503	6	441	ChainA, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]
6PSM_A	3.55e-55	33	502	23	444	Crystalstructure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_B Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_C Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_D Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_E Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_F Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSO_A Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea],6PSO_B Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea]
6PRM_A	1.86e-54	33	502	23	444	Crystalstructure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_B Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_C Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_D Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ9	5.18e-51	9	515	16	543	Sulfatase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22020 PE=3 SV=1
P34059	3.70e-37	35	472	31	450	N-acetylgalactosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GALNS PE=1 SV=1
P77318	4.27e-37	34	487	57	526	Uncharacterized sulfatase YdeN OS=Escherichia coli (strain K12) OX=83333 GN=ydeN PE=3 SV=2
Q32KH5	3.33e-36	35	460	30	446	N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris OX=9615 GN=GALNS PE=2 SV=1
Q9X759	8.34e-36	23	488	14	522	Arylsulfatase OS=Klebsiella pneumoniae OX=573 GN=atsA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000333	0.999053	0.000176	0.000157	0.000141	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000222_01011.