CAZyme Information: MGYG000000222_02303

Basic Information

• Species: Parabacteroides sp003473295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003473295
• CAZyme ID: MGYG000000222_02303
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
457	MGYG000000222_17|CGC1	52750.73	6.9147

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000222	4189286	Isolate	China	Asia

• Gene Location: Start: 26144; End: 27517 Strand: +

Full Sequence      

MIRNFLLIQLFFLGCIFSIYAQEDVWQGPSVNFSHGKLQISENGRYLVHKDGTPFLYIGD
TAWELFHRLNEQEVEKYLENRRAKGFTVIQAVILAELNGLNTPNVYGETPLIDNNVLQPN
EKYYKWVDKVIRMAEAKGLYIGLLPTWGDKVDKQWGVGPEIFNPMYAGLYGTWLGRRYKN
FKNIIWINGGDRWGGDNNYPIWEALGKALKKADKNHLITFHPQGECSSGQWFHNSTWLDF
NMAQTGHCQRNYEIYNRLLLKDYNRTPVKPCMDGEPRYENHPVCWKPDSLGWFDDTDVRQ
ALYWDLFSGSCGHTYGCHDIWQMKTPEREAIGFARGNWQTSLDLPGAFDLIHARRLLERY
DWASRKPAPDMIISDNSSFEHKIVALQGNGFALVYFPNGEKATFNLQSISKNNELTLSWM
NPRTGEIKKTGSIDRSQTQEIIPPSSGRGNDWVLIIE

Enzyme Prediction     

No EC number prediction in MGYG000000222_02303.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	36	454	1.4e-150	0.9975728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	5.75e-157	43	360	1	320	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	1.54e-23	367	457	2	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI62058.1	1.82e-251	11	457	5	461
BBE19187.1	2.00e-201	7	457	4	453
SCD20980.1	5.54e-194	4	457	4	462
SNV48981.1	1.88e-185	18	457	17	455
QNL39863.1	8.79e-171	1	457	1	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	1.88e-85	27	456	7	444	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	1.94e-81	27	456	7	444	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	8.06e-79	31	456	24	460	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000421	0.988514	0.010404	0.000237	0.000218	0.000200

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000222_02303.