CAZyme Information: MGYG000000222_02672

Basic Information

• Species: Parabacteroides sp003473295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp003473295
• CAZyme ID: MGYG000000222_02672
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
260		30592.24	6.4715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000222	4189286	Isolate	China	Asia

• Gene Location: Start: 54343; End: 55125 Strand: -

Full Sequence      

MKCINLILLSGGLGNQMFQYALAMALSKMGKDVYVNGFIADYENDHNGMELHDVFNIDTS
NGFLTNLFVKFIYKFVVKYRKYSSLMSVIGVECLFDVDNNFDWIKSCSNLKLFNIWFGRF
QSELFFLNCKDEILRTFQFDGKKVSCDTRNVVDNIMRNESVSIHIRKGDYMDRKNYDLYA
NICTDKYYQYCVSIIKDKIDNPIFFVFSDDKKWVLENLELPINTVFVDWNVGRESWKDMY
LMSICKHNIIANSTFSWWAA

Enzyme Prediction     

No EC number prediction in MGYG000000222_02672.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	7	260	2.1e-55	0.8514492753623188

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	8.42e-50	8	260	6	238	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.59e-21	7	260	4	263	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC95288.1	2.47e-52	4	260	1	256
QTL97698.1	1.77e-51	4	260	1	239
QXP69641.1	2.42e-50	1	260	1	263
QXP64992.1	2.42e-50	1	260	1	263
QXP67481.1	2.42e-50	1	260	1	263

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	1.24e-22	9	260	5	269	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q10980	3.65e-08	125	260	174	316	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Fut1 PE=2 SV=2
O09160	4.92e-08	161	260	217	317	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Mus musculus OX=10090 GN=Fut1 PE=1 SV=2
Q10979	5.16e-07	161	260	215	315	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Oryctolagus cuniculus OX=9986 GN=FUT1 PE=2 SV=1
O77487	8.71e-07	161	260	196	296	Galactoside alpha-(1,2)-fucosyltransferase 2 OS=Pongo pygmaeus OX=9600 GN=FUT2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000222_02672.