CAZyme Information: MGYG000000223_01170

Basic Information

• Species: NSJ-61 sp003433845
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; NSJ-61; NSJ-61 sp003433845
• CAZyme ID: MGYG000000223_01170
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
912		99228.83	5.1278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000223	4367631	Isolate	China	Asia

• Gene Location: Start: 106720; End: 109458 Strand: +

Full Sequence      

MEKNPDNKQKTVKKKKPRRSILDRVIIVFLALVLIGGVSVFGVFAKIVSEVETKDLPSKI
VSKEPSEIYGVRNGKQVLMNEIGGESREVITYEQIPQVTIDAFLAIEDSRFYSHNGFDLP
RFISSAMNNLKNKDLSQGGSTLTMQTIDNYIIKPKEEEDKKNGVTYSSLDKIVSKIKEIY
LSMALDNDVSKEYIITAYLNQINFGQHARGIQKGAQYYFGKNVEELNLSESAFLAGVINA
PNAFNPYNGVVGNVNYYKAATNRRNETLDMMVNHGYITKEEAALAKSTKLAFQLAGGSSS
SDDSSFNAITNQVAKEVQKLTGQDPYTTPMKIYTSIDLDAQEQATKLCSGEGLTLLDNKY
YQFGFTMMNNQTGEIVAIGPGLNVDYASGNWKDMSIEPRQPGSSIKPVLDYALTFDKLGW
STAHTLKDEAVDMGGYNLVNADGKYHGDVSMEQAITESFNPPAIKSLQAIIGKIGVDGVV
EYMNKAGFNNITTENFNTQFGIGSSEMEASPTQMAAAYASFANGGYYIEPHMVTKVEFKD
GSKILDPKYEKTSIMSPQAAYMMSDLLNKAVSGKYSVQGAFLRDLLDSSYTAYGKTGTTN
WGENSYGIEPMAIKDNWMIGYTSNYVCATWTGFDGGAETGTTYISYEDLLATRTPGKICS
TMLKTVSRGAGPIQRPSGLSDITVMKGMYPYKLAPKGAKDAISGLIKSEYAKNLENATIT
PPSNLVNFVVTKANAAGTDIDFTFGAYPGDKNSDMIKMYGDIVYKVVITVDGSVTKQETY
TSTTGRISGAIPEGKTGKVCGFYQYKNSDDAKAKSNEKCVEISATAAVSKDSLSSLYQSA
SALNNAEYTPESWLALDSARQAAKIVMDNTSATQAEVDQALNNLQNAVNGLVKNTPEAPT
PPADNQGETPAP

Enzyme Prediction     

No EC number prediction in MGYG000000223_01170.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	78	272	6.5e-53	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	2.17e-137	87	669	2	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	7.41e-136	17	642	8	580	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	9.93e-92	21	642	4	705	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
TIGR02073	PBP_1c	5.31e-69	93	637	39	522	penicillin-binding protein 1C. This subfamily of the penicillin binding proteins includes the member from E. coli designated penicillin-binding protein 1C. Members have both transglycosylase and transpeptidase domains and are involved in forming cross-links in the late stages of peptidoglycan biosynthesis. All members of this subfamily are presumed to have the same basic function. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG4953	PbpC	4.24e-68	83	694	54	606	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM11680.1	0.0	1	912	1	912
QSI26123.1	1.91e-236	21	747	21	731
ANU69519.1	1.22e-233	21	680	21	678
ASU18048.1	1.22e-233	21	680	21	678
QQR26595.1	1.22e-233	21	680	21	678

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DWK_A	1.05e-73	65	680	7	603	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	1.08e-69	58	680	9	612	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
3ZG8_B	2.64e-48	185	634	3	433	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	4.22e-44	185	634	3	433	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3UDF_A	5.92e-43	64	640	19	695	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39793	2.41e-95	14	813	26	781	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q04707	3.21e-66	29	689	17	641	Penicillin-binding protein 1A OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=ponA PE=1 SV=2
Q8DR59	8.25e-66	29	689	17	641	Penicillin-binding protein 1A OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=pbpA PE=1 SV=1
Q00573	8.08e-65	28	633	20	600	Penicillin-binding protein 1A (Fragment) OS=Streptococcus oralis OX=1303 GN=ponA PE=3 SV=1
P38050	6.11e-64	12	694	4	634	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.882973	0.099372	0.000821	0.001020	0.000493	0.015333

TMHMM  Annotations     

start	end
21	43