CAZyme Information: MGYG000000224_01111

Basic Information

• Species: Bacteroides sp003545565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp003545565
• CAZyme ID: MGYG000000224_01111
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687	MGYG000000224_3|CGC5	79733.27	6.456

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000224	3747034	Isolate	China	Asia

• Gene Location: Start: 311460; End: 313523 Strand: -

Full Sequence      

MKPIKSLTFVLTAFFLSVFIMPFSLAQTPMPMNYRNNLYPLQRKPYIQLPIGSIKPKGWL
KEMLLRQRNGMSSQLDKLYPEVMGIRNGWLGGDGDQWERGPYWIDGLLPLSYLLDDEEMK
RKVQPWIEWALNSQRKDGFFGPSRNYEPEPGLQRNNSEDWWPRMVILKIMKQHYEATGDT
RIIPFLTRYFRYQLQTLPQKPLGYWTFWAEYRACDNLQIVYWLYNITGEPFLLDLGKLLH
KQGYDYVDMFLRRDDLTRINTIHGVNLAQGIKEPIIYYQQDPDSTYIYAVKKAFADIRKY
HGQPQGMYGADEALHGNKPTQGAELCSIVELMYSLESMLEITGDIQFADHLEKLAYNALP
THITDDFMARQYFQQPNQVMLTRHEHNFDINHCETDIVYGLLTGYPCCTSNFHQGWPKFT
QNLWYATADNGIAALVYAPSEATIKVGQGVDVHVTETTTYPMGNNIMFTFNFPNSINTSC
NFPLHLRIPAWCKGAEIKINGKTIQLSGSQSGIEIIKREWHEGDQLELSLPMNVFTSEWY
ENSVAVERGPLVYSLKIGEKWVKKQIKDDPVRFGTSYNEVLPTTSWNYGLIDFDTINFSK
NFIVVEHPEKMKAKYFWNQESAPIEIKVKAKKIPSWTLYNEMAGPQPYSRMIYGINKEES
SEEEITLIPYGCTTLRITEFPVLGKFD

Enzyme Prediction     

No EC number prediction in MGYG000000224_01111.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	323	553	1.1e-33	0.42366412213740456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.21e-56	102	554	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.71e-26	323	558	291	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK64903.1	3.76e-158	26	684	14	646
ARS39276.1	1.72e-155	37	685	29	650
QDW25584.1	7.94e-154	37	685	31	652
QNR86060.1	1.49e-153	37	685	29	650
AMP98056.1	6.58e-153	25	684	19	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.43e-17	103	556	82	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	1.08e-16	93	556	100	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	1.75e-16	103	556	82	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000298	0.999022	0.000187	0.000167	0.000154	0.000149

TMHMM  Annotations     

start	end
7	26