CAZyme Information: MGYG000000224_02628

Basic Information

• Species: Bacteroides sp003545565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp003545565
• CAZyme ID: MGYG000000224_02628
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000000224_9|CGC1	30761.52	6.835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000224	3747034	Isolate	China	Asia

• Gene Location: Start: 81042; End: 81848 Strand: -

Full Sequence      

MVSIDMKKIVCIQILLWVLCLINVSAQSSYKGYEQNVYVSSQGDSLRYCLLRPEVEKPGE
KYPLVLFLHGAGERGNDNRKQLKHGGQMWLNPVNRKKYPAFILLPQCSAENYWGYATRPD
SFEPFEMPDNPELTTTIRTLKSLLDTFLDMPQVDKLRVYIMGLSMGGMATYDMVIRYPEI
FAAAVPICGTVNPVRIEKELREIKFRIFHGDTDSVVTPEGSREAYKALKAIDASVEYIEF
VGCDHNSWNPAFNYPDFMSWLFNQKKEK

Enzyme Prediction     

No EC number prediction in MGYG000000224_02628.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	43	246	1.3e-25	0.8942731277533039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4099	COG4099	6.52e-52	37	265	165	386	Predicted peptidase [General function prediction only].
COG1506	DAP2	2.31e-13	34	245	366	594	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
TIGR01840	esterase_phb	4.13e-09	61	189	12	128	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
COG0400	YpfH	2.74e-07	53	240	8	184	Predicted esterase [General function prediction only].
COG3509	LpqC	5.34e-07	41	243	42	237	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABS60377.1	1.63e-44	33	267	10	246
BCI61582.1	2.31e-40	33	267	811	1044
QDU56037.1	1.13e-30	31	268	789	1009
QJW99051.1	3.95e-28	31	266	32	240
VTR91196.1	7.69e-28	31	266	31	239

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DOH_A	2.75e-45	43	266	155	380	CrystalStructure of a Thermostable Esterase [Thermotoga maritima],3DOH_B Crystal Structure of a Thermostable Esterase [Thermotoga maritima],3DOI_A Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima],3DOI_B Crystal Structure of a Thermostable Esterase complex with paraoxon [Thermotoga maritima]
3WYD_A	5.14e-18	28	268	3	219	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]
4Q82_A	2.45e-10	60	266	78	277	CrystalStructure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365],4Q82_B Crystal Structure of Phospholipase/Carboxylesterase from Haliangium ochraceum [Haliangium ochraceum DSM 14365]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000198	0.999196	0.000151	0.000149	0.000139	0.000131

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000224_02628.