CAZyme Information: MGYG000000224_02931

Basic Information

• Species: Bacteroides sp003545565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp003545565
• CAZyme ID: MGYG000000224_02931
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		43579.91	5.8628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000224	3747034	Isolate	China	Asia

• Gene Location: Start: 46231; End: 47352 Strand: +

Full Sequence      

MKRVYIYIVIALCGVSACTSSRQRILEDTRLGLVDKHATDLTAILFHNLKQMTGKYVVYG
QHNYEMDGFDSDTSRWRDEQNRCDAYDVTGAYPAMASFDFLHFTNPVSWETKNLDYIKSK
FYAAYERGNVLTFCWHYYNPVTGNNFYDTTQVVKHILPGGSRHETFKSDLRIIADFAHNA
KNHAGELIPIIFRPWHEFDGNWFWWGRNHCTVEEFKELYRFTVTYLRDSLQVHNFLYAFS
PDCGFTTEKEFLERYPGDEYVDVVGMDNYWDFRSDGGDTSLVVLKSRILTKYAKEHNKLS
AITETGTQTRDSLWYSQLLNILYFEGVELNYLCTWSGFAPYKGHPAASDFYQFKEDSLIL
FADEAPDFYVLTK

Enzyme Prediction     

No EC number prediction in MGYG000000224_02931.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	34	339	3.5e-67	0.9141914191419142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.37e-33	34	338	1	285	Glycosyl hydrolase family 26.
COG4124	ManB2	3.15e-16	77	279	78	266	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUA17418.1	2.52e-230	1	369	1	368
AKA50870.1	2.52e-230	1	369	1	368
BAD47590.1	2.52e-230	1	369	1	368
QCQ40508.1	3.58e-230	1	369	1	368
ANQ59508.1	1.02e-229	1	369	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q78_A	2.40e-75	27	371	51	414	Thestructure of GH26C from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q78_B The structure of GH26C from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
2VX4_A	2.39e-69	16	369	15	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	2.39e-69	16	369	15	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	4.42e-69	16	369	38	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	1.87e-68	16	369	15	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1A278	1.89e-50	31	364	40	397	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49424	3.25e-45	13	335	28	360	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
P55278	2.54e-16	71	352	65	339	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
O05512	4.71e-16	136	336	141	325	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	2.46e-14	33	307	146	409	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000044	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000224_02931.