CAZyme Information: MGYG000000224_03030

Basic Information

• Species: Bacteroides sp003545565
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp003545565
• CAZyme ID: MGYG000000224_03030
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
781		89163.26	6.8876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000224	3747034	Isolate	China	Asia

• Gene Location: Start: 49536; End: 51881 Strand: -

Full Sequence      

MKSSLTCLLLFFFLLTGKAQTRQEVSYFPLQDVKLLESPFLQAQQTDLHYIMAMNPDKLL
APFLREAGLTPKAPSYTNWENTGLDGHIGGHYISALSMMYAATGDTTVYNRLNYMLDELY
RAQQAVGTGFIGGTPGSLQLWKEIKEGNIHAGSFNLNGKWVPLYNIHKTYAGLRDAYLYA
GSDLARQMLIALTDWMADITSGLTDEQMQDMLRSEHGGLNETFADVADITGDKKYLELAR
KFSHKTLLEPLTKDEDCLTGMHANTQIPKVIGYKRIADLTQDHDWDHAAHFFWNTVVKHR
SVCIGGNSVREHFHPADNFTSMLNDVQGPETCNTYNMLRLTKMLFQSSPDSRFADYYERA
LYNHILASQQPAKGGFVYFTPMRSGHYRVYSQPETSMWCCVGSGLENHTKYGEFIYAHTE
DTLYINLFIPSRLTWKEKNLVLAQESRFPDEEQIRFRVEKSTKKAFSFKFRYPAWAKGAS
VSVNGKVQDITAQPGEYLTIHRKWKAGDEITLNLPMQVTLEQIPDQEQFYAFMYGPVVLA
NPTGTENMDGLYADDSRGGHIAHGKQVSLEKIPMLIGSSESLSQAVRKTDDKQLSFNYTG
SVYPAQKEALKLIPFFRLHDSRYAIYFHRVTQTEAESIRKEMELKERKAMELANQTVDII
FPGEQQPESDHGIQYEQAEAGTNKDRHFRRAKSWFSYNLKVKEEAGRLMIVTRKEDKMKV
SILLNNEKLTVNPTISEPDKEGFITVCYPLSRKLSAGNYPIRFSPDETEWTPAIYEIRLL
K

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	32	540	2.2e-219	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	32	540	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.46e-129	30	616	9	571	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	4.28e-38	544	627	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT46350.1	0.0	1	781	1	781
QRQ48086.1	0.0	1	781	1	781
QUT90786.1	0.0	5	781	6	782
ALJ58196.1	0.0	5	781	6	782
QDO70922.1	0.0	1	781	1	789

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OPJ_A	0.0	17	781	17	802	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6YQH_AAA	0.0	1	781	1	802	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	8.02e-22	282	538	285	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	9.92e-21	282	538	285	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	2.87e-18	324	520	375	583	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000258	0.999108	0.000203	0.000158	0.000143	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000224_03030.