CAZyme Information: MGYG000000226_01122

Basic Information

• Species: Lactococcus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus lactis
• CAZyme ID: MGYG000000226_01122
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MGYG000000226_3|CGC2	54301.27	4.5537

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000226	2362991	Isolate	China	Asia

• Gene Location: Start: 163480; End: 164916 Strand: -

Full Sequence      

MKVLFASSECAPFFKTGGLGDVAGALPKELAKKSEIDSVAVILPYFKNEMKEEYRSLLKD
EFYDFVDVGWRHEYVGVKSLEKEGVKYYFLDNEHYFGRGQLYGYGDDGERFAFFDLALCQ
LLEKLDFIPDVLHVNDWQTAMVPFLLKEKYNWIKAYEKIKTVLTIHNIEFQGLMHGDALS
ELFGMGMERYFEGVVRHNGMLNMLKTGILYADRVNTVSPTYAKEIQTSEFGCGLESILQY
VDGKVSGILNGIDYDIYNPENDILIPYHFSEEELSGKGQMKAELQKRTGLPLNPNVPLIG
MVSRLTNQKGFDLVLSQLEKVLEENVQIVLLGTGFPEIEEGFRYFSQKYPDKLSANIAFD
LQFAQEIYAGSDFFLMPSAFEPCGLSQMIAMRYGTLPIVHEIGGLKDTVIPFNPISKEGT
GFGFVDFEGQILLETINRALEVYGKEPEVLNKMVLTAMSKDFSWGTKAQQYIELYQEL

Enzyme Prediction     

No EC number prediction in MGYG000000226_01122.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	2	476	5.5e-176	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	1	478	1	478	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	1	478	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	1	478	1	463	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	2	477	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	3.11e-116	1	478	4	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA60127.1	0.0	1	478	6	483
AIS03283.1	0.0	1	478	6	483
ARE20291.1	0.0	1	478	1	478
ARE13000.1	0.0	1	478	1	478
ARE15407.1	0.0	1	478	1	478

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HLN_A	3.48e-93	2	476	126	623	Structureof barley starch synthase I in complex with maltooligosaccharide [Hordeum vulgare]
3D1J_A	2.91e-91	1	478	1	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	2.03e-90	1	478	1	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.59e-89	1	478	1	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
6GNE_A	3.05e-85	1	475	10	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9CHM9	0.0	1	478	1	478	Glycogen synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=glgA PE=3 SV=2
Q3K1K2	1.32e-206	1	478	1	475	Glycogen synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=glgA PE=3 SV=1
Q8E079	1.32e-206	1	478	1	475	Glycogen synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) OX=208435 GN=glgA PE=3 SV=1
Q8E5V5	5.35e-206	1	478	1	475	Glycogen synthase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=glgA PE=3 SV=1
B9DRS8	1.16e-205	1	478	1	475	Glycogen synthase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) OX=218495 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000226_01122.