CAZyme Information: MGYG000000226_01180

Basic Information

• Species: Lactococcus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus lactis
• CAZyme ID: MGYG000000226_01180
• CAZy Family: CE4
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000000226_3|CGC5	34296.56	8.5929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000226	2362991	Isolate	China	Asia

• Gene Location: Start: 232776; End: 233669 Strand: -

Full Sequence      

MKFSKKNIFLILMFGLIAILVFMSTRETKKYVQDGKKEQPDFAYESLLKDNDGIIVLCYH
RVLKDTVVTNFAYSISHNSQLHEYNVFLQDFEQQMTFLKKNHIKVLTSSELIEKLNKKEV
IGKAVVITFDDIDKSLPENAYPIMKKLDLPFTQFIITGKVGQTIDGSQMSTWKEIKKMNE
NPLVTSGLHTNDLHYQENFEPILSTNISKKVVQKDYQKSQKAFDEKLDQKGKVFAYPYGA
QNKDLEDYMLQDGIQGIFTLSPGVVTNETLYSNIPRLIVTKDNWKTIKHWLLSEGTQ

Enzyme Prediction     

No EC number prediction in MGYG000000226_01180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	122	255	9.5e-19	0.8846153846153846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10965	CE4_IcaB_5s	2.89e-88	121	291	1	172	Putative catalytic polysaccharide deacetylase domain of bacterial intercellular adhesion protein IcaB and similar proteins. The family is represented by the surface-attached protein intercellular adhesion protein IcaB (Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase, EC 3.5.1.-), encoded by Staphylococcus epidermidis icaB gene from the icaABC gene cluster that is involved in the synthesis of polysaccharide intercellular adhesin (PIA), which is located mainly on the cell surface. IcaB is a secreted, cell wall-associated protein that plays a crucial role in exopolysaccharide modification in bacterial biofilm formation. It catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also referred to as PIA), a biofilm adhesin polysaccharide. IcaB shows high homology to the N-terminal NodB homology domain of Escherichia coli PgaB. At this point, they are classified in the same family.
cd10918	CE4_NodB_like_5s_6s	2.36e-37	124	282	1	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10973	CE4_DAC_u4_5s	3.46e-28	123	282	1	156	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10969	CE4_Ecf1_like_5s	4.67e-28	91	288	4	211	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	1.43e-24	117	257	1	124	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIS03225.1	4.23e-214	1	297	1	297
ARD98333.1	1.72e-213	1	297	1	297
QSD59788.1	1.72e-213	1	297	1	297
QTP12614.1	1.72e-213	1	297	1	297
ARE10481.1	1.72e-213	1	297	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WCJ_A	1.39e-33	52	290	35	259	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
6DQ3_A	7.50e-07	91	272	37	202	ChainA, Polysaccharide deacetylase [Streptococcus pyogenes],6DQ3_B Chain B, Polysaccharide deacetylase [Streptococcus pyogenes]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6G606	6.31e-35	1	290	1	283	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q8NUI6	6.31e-35	1	290	1	283	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1
Q9RQP7	6.31e-35	1	290	1	283	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaB PE=3 SV=2
Q5HCM9	6.60e-35	1	290	1	283	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaB PE=3 SV=1
Q7A349	8.83e-35	41	290	32	283	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.783349	0.192456	0.021043	0.000649	0.000382	0.002134

TMHMM  Annotations     

start	end
7	24