CAZyme Information: MGYG000000226_01182

Basic Information

• Species: Lactococcus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus lactis
• CAZyme ID: MGYG000000226_01182
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
406	MGYG000000226_3|CGC5	46880.59	6.8861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000226	2362991	Isolate	China	Asia

• Gene Location: Start: 233942; End: 235162 Strand: -

Full Sequence      

MIISTMVDVYVVYYPIILSFIWASGAFLSRWKERDKKAIDETKEFEKISIVISAYNEEET
IEEVLLSLHNLNYPSLEIFIVDDKSSDRTLEKLYEVKKSFDDWETLTILEQKENKGKATA
LNVALQQVNSKYMLVIDADSYLSKDALSYLLAELTSSSDIGAVTGRPIVRNRTTLLGKLQ
TLEYLSVIDAIKRAQSLFLGAIMTVSGVIVMYRVEALKEIGGFNTEVMTEDIDVTWRLHR
NQWKVKYVPKALSYILVPENLKSLLKQRRRWAVGGVEVLISNLSWVFKRGEFKHRFLLIE
MICSHIWSWFFLIESYQYFLQMLLNQEFKVSGQIIVIFVLISFFVFFLGLNNDKGESRLS
LTDKLIFPAYLVAYWFLNLISALSAELVVLTNRTNKGKWESPDRGV

Enzyme Prediction     

No EC number prediction in MGYG000000226_01182.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	48	274	6.1e-36	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11204	PRK11204	6.31e-114	10	406	13	418	N-glycosyltransferase; Provisional
PRK14583	hmsR	6.35e-75	10	406	33	439	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
COG1215	BcsA	3.57e-68	10	380	14	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	5.44e-62	50	231	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06439	CESA_like_1	4.47e-36	9	275	1	248	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE20274.1	2.96e-285	1	406	1	406
ATZ00797.1	2.96e-285	1	406	1	406
ATY87172.1	2.96e-285	1	406	1	406
QOK50736.1	2.96e-285	1	406	1	406
ARE03040.1	5.98e-285	1	406	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	2.33e-14	44	290	126	389	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4P00_A	2.45e-14	44	290	139	402	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.45e-14	44	290	138	401	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
6YV7_B	1.43e-11	47	291	43	276	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	1.44e-11	47	291	44	277	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GLC5	6.13e-74	10	405	6	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q5HKQ0	1.22e-73	10	405	6	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8XAR5	7.53e-69	10	406	33	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
P75905	2.09e-68	10	406	33	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q6GDD8	4.19e-67	10	405	6	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999634	0.000384	0.000007	0.000001	0.000001	0.000005

TMHMM  Annotations     

start	end
10	29
197	214
296	313
334	351
366	388