CAZyme Information: MGYG000000226_01734

Basic Information

• Species: Lactococcus lactis
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus lactis
• CAZyme ID: MGYG000000226_01734
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
162	MGYG000000226_5|CGC1	18972.38	9.1747

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000226	2362991	Isolate	China	Asia

• Gene Location: Start: 147673; End: 148161 Strand: +

Full Sequence      

MIFVTVGTHEQPFNRLIKKIDDLVREEKITEEVYMQIGYSSYIPKHTQYSKVIGYKEMNK
LMLKSDIIITHGGPSTYMQVIQMGKVPVVVPRQLKFEEHVNDHQLLVTKKVLEKGYPLIM
CQDVENILIDMEKVKKMKSHSKITNNDEFVKKFILEVGRIFE

Enzyme Prediction     

No EC number prediction in MGYG000000226_01734.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5017	COG5017	1.64e-24	1	129	1	129	UDP-N-acetylglucosamine transferase subunit ALG13 [Carbohydrate transport and metabolism].
pfam04101	Glyco_tran_28_C	7.66e-16	1	154	1	159	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
COG0707	MurG	1.96e-06	18	157	196	351	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
cd03785	GT28_MurG	2.16e-06	11	142	194	336	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
cd17507	GT28_Beta-DGS-like	3.59e-05	51	139	253	340	beta-diglucosyldiacylglycerol synthase and similar proteins. beta-diglucosyldiacylglycerol synthase (processive diacylglycerol beta-glucosyltransferase EC 2.4.1.315) is involved in the biosynthesis of both the bilayer- and non-bilayer-forming membrane glucolipids. This family of glycosyltransferases also contains plant major galactolipid synthase (chloroplastic monogalactosyldiacylglycerol synthase 1 EC 2.4.1.46). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIS02722.1	1.49e-113	1	162	1	162
CEN27314.1	6.09e-67	1	160	1	160
ARD97485.1	6.26e-66	1	161	1	162
BAL42832.1	6.26e-66	1	161	1	162
CAD0163108.1	2.54e-65	1	161	1	162

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000226_01734.