CAZyme Information: MGYG000000227_00475

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_00475
• CAZy Family: CE12
• CAZyme Description: Rhamnogalacturonan acetylesterase RhgT

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
99	MGYG000000227_1|CGC3	11295.85	5.8391

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 472237; End: 472536 Strand: -

Full Sequence      

MLVTTQSKRTFDENGVFYNSIGEYPNAMKELGRNMNVPVIDLNRKSIAYYNAIGVEATKQ
VFMFLKPGESPNYPDGVEERVHFQEYGANPEKQKSMIVI

Enzyme Prediction     

No EC number prediction in MGYG000000227_00475.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	2	89	1.9e-24	0.4142857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	8.19e-29	2	89	112	188	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB89978.1	3.73e-68	1	99	1	99
QHZ49053.1	1.81e-48	1	89	260	348
AMR12700.1	2.79e-48	1	89	117	205
AAU22929.2	2.79e-48	1	89	117	205
ARC65973.1	1.06e-46	1	89	260	348

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	3.55e-25	1	88	114	201	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	6.85e-08	2	89	114	192	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000227_00475.