CAZyme Information: MGYG000000227_03002

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_03002
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
390	MGYG000000227_6|CGC2	43501.21	4.9422

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 29765; End: 30937 Strand: +

Full Sequence      

MANILMINVPAEGHVNPTLGIAKAFAERGDNVHYVTTEKFKERLEALGVHVHLQPDFMKQ
LKGVDSVLKIMIQIAKDTLSIVKELAEQIEFDFVYYDTFGAGKLARDYLGIPGISSSSSF
LFSEEFMKKHGPIKAAQGNPEVERLIREIEDQFGVVVDSPAQFMRNDGELNIVYTSRYFQ
PDSGQYGDEYVFIGPSFPERKDSRRGFQVETLRGERVLYISMGTVLDNKEAFFNTCIDAF
SDFQGKVVIAAGERADQSRLKEAPGHFIISSYVPQLEVLQQADVFITHGGMNSVNEAIHY
EVPLVVIPHDKDQPVVAARLAELGAGYTLSEDDVNADTLKEAVNEAVENAAYLQGIRKIK
DSFQHSGGVRRALEAVDRFVEEKKQSLGNR

Enzyme Prediction     

No EC number prediction in MGYG000000227_03002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	168	380	1.8e-43	0.5287958115183246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	2.88e-101	7	382	1	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
COG1819	YjiC	9.13e-70	4	386	4	405	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	3.85e-59	2	379	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
PHA03392	egt	3.08e-18	217	365	298	448	ecdysteroid UDP-glucosyltransferase; Provisional
cd03785	GT28_MurG	2.42e-12	13	371	11	346	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB90799.1	6.94e-283	1	390	2	391
ATH93153.1	3.95e-243	1	387	1	387
QAT66961.1	3.61e-239	1	387	1	387
SCA87781.1	3.61e-239	1	387	1	387
QHZ45575.1	2.18e-232	1	384	1	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	4.17e-62	3	382	5	387	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	4.75e-62	3	382	5	387	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
2IYA_A	7.19e-41	3	382	14	422	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3RSC_A	2.27e-40	2	380	21	412	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora],3RSC_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP and calicheamicin T0 bound form [Micromonospora echinospora]
3IAA_A	2.32e-40	2	380	21	412	CrystalStructure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora],3IAA_B Crystal Structure of CalG2, Calicheamicin Glycosyltransferase, TDP bound form [Micromonospora echinospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05496	3.64e-154	1	385	1	395	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
O31853	5.99e-87	1	386	1	402	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O34539	2.60e-61	3	382	5	387	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	8.32e-56	3	380	5	390	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
Q9XC67	2.58e-36	1	377	58	454	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000227_03002.