CAZyme Information: MGYG000000227_03437

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_03437
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000000227_7|CGC7	37277.68	6.2268

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 173897; End: 174913 Strand: +

Full Sequence      

MKKRAVSIVIALLCFSAASQTSYAHTVSPVNPDAGQTTKAGMNWLAHLPNRSDNRVMSGA
FDGYSRDTFSVAEADRLKHATGQLPAVYGCDYARGWLEPENIADTIGYSCNSELISYWKS
GGIPQISMHLANPAYSTGHFKTPISNSQYQNILDSSTTEGKRLDAMLGKIADGLQQLKDE
GVTVLFRPLHEINGDGFGGGLDSIIKKQRENLFVQTAYQKIYHYMTNERGLDNLLWVYAP
DANRDFKTDFYPSVSYVDIVGLDAYFTDSYSIKGYDELTSLHKLFAFTEVGPQETNGGLD
YSSLINAIKQNHPKTVYFLAWNDGWSPAANKGAANSLS

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	30	331	1.9e-74	0.9306930693069307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	4.49e-113	30	333	1	297	Glycosyl hydrolase family 26.
COG4124	ManB2	5.57e-69	2	333	4	329	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB87480.1	8.65e-255	1	338	1	338
QHZ49182.1	2.97e-185	1	335	2	337
QFY39913.1	4.28e-180	1	333	1	334
AYQ15323.1	4.28e-180	1	333	1	334
QEO05951.1	4.28e-180	1	333	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2QHA_A	7.77e-173	25	334	1	311	FromStructure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis],2QHA_B From Structure to Function: Insights into the Catalytic Substrate Specificity and Thermostability Displayed by Bacillus subtilis mannanase BCman [Bacillus subtilis]
2WHK_A	1.47e-171	25	334	1	311	Structureof Bacillus subtilis mannanase man26 [Bacillus subtilis]
3CBW_A	2.69e-171	24	334	9	320	ChainA, YdhT protein [Bacillus subtilis],3CBW_B Chain B, YdhT protein [Bacillus subtilis]
7EET_A	4.78e-100	26	338	9	335	ChainA, Mannanase KMAN [Klebsiella oxytoca]
3WDQ_A	3.54e-24	28	337	33	334	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05512	6.13e-172	2	334	3	337	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	4.14e-160	1	333	2	334	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
P16699	1.82e-97	19	333	24	340	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1
A1A278	1.66e-13	48	321	58	358	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
Q5AWB7	1.40e-12	26	291	25	298	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999005	0.000209	0.000185	0.000167	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000227_03437.