CAZyme Information: MGYG000000227_04268

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_04268
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219		25441.6	10.9083

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 46296; End: 46955 Strand: +

Full Sequence      

MTKSVYEFWLSQGKDKLRFPVLPEKIDVTNNMGNETVKVAQFGEVTFINDPNAKTISFSS
YFPKKYSPLTEYKGFPSPENAIATIERWIKNKKPVRFLVTGTKINLNCSIEAFTHSEGQK
DIGDRDFDITLKEYKTVSPRKIKQKKKTKKKRPSKSAPKVYTVKKGDTLWHIAGRFYGNS
LQWRKIWNANKKAMIKRSKRNIRQPGHWIFPGQKLKIPQ

Enzyme Prediction     

No EC number prediction in MGYG000000227_04268.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	161	218	9.8e-16	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1652	XkdP	7.30e-37	1	219	51	263	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
PRK11198	PRK11198	1.84e-14	157	219	94	147	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	4.96e-09	159	217	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.40e-08	161	217	2	44	Lysin motif.
pfam01476	LysM	1.47e-08	161	218	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB88441.1	1.11e-161	1	219	1	219
QHZ46379.1	9.44e-154	1	219	1	219
QNT74144.1	1.57e-152	1	219	1	219
QEO07801.1	3.16e-152	1	219	1	219
ARC68671.1	3.16e-152	1	219	1	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6VE2_O	2.47e-06	158	217	28	77	ChainO, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_P Chain P, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_Q Chain Q, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_R Chain R, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_S Chain S, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_T Chain T, LysM domain-containing protein [Pseudomonas aeruginosa PAO1],6VE2_U Chain U, LysM domain-containing protein [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45932	5.03e-134	1	219	1	219	Uncharacterized protein YqbP OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbP PE=4 SV=1
P54335	1.61e-130	1	219	1	219	Phage-like element PBSX protein XkdP OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdP PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000227_04268.