CAZyme Information: MGYG000000227_04867

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_04867
• CAZy Family: GT2
• CAZyme Description: Plipastatin synthase subunit C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1445		163606.8	5.5944

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 75; End: 4412 Strand: +

Full Sequence      

MSFTLQTAALGEQTEQEAASAFIQPFDLSQAPLFRAQIVKVSDERHLLLVDMHHIISDGV
SVNILIREFGELYNNRTLPALHIQYKDYAVWQEKFKKGDTYKKQEAYWLKQLEGELPVLD
LPADHTRPPVRSFAGDQVAFTLDEKLKAGLHQLAREHGSTLYMVLLAAYTALLSRXXXXY
MVLLAAYTALLSRLSGREDIIVGSPIAGRPHKDLEPILGMFVNTLALRTRPEGGKPFAEY
LQEVRETALEAYEHQDYPFEELVDQLGVPRDTSRNPLFDVMFVLQNMDQESVQLENLRLR
PATNNGHQVSKFDLTLYAHEDSHGLTTFQMEFNTDLYKKKTIEKWLQYFINMLRNITQDS
EAALGTIHLMDEEETHFLIHELNRTKREYPRDETISRLFELQAEQTPDAIAVVSDKQVLT
YAELNSRANRIAAVLREKGVGPERVVALLTTRTPELAAGMLGILKAGGAYLPIADDLPAE
RISFMLSDSGAQILLRSEKTENRPLEIEMECEQIVIENIQGQGETKNLEPLGGPNSLAYI
IYTSGSTGKPKGVMIEQRSVIRLVKNSNYIEFTSEDRLLLTSSIGFDVVTFEIFGPLLNG
AALHLSDKETFLDDHQLERYIEHQAITTMWLTSSLFNHLTEQNEKLFYRLKHLIIGGEAL
SASHVNRVRHACPELAIWNGYGPTENTTFSTCFPIDKTYEHSIPIGRPVGNSTAYILNKW
GMLQPIGAVGELCVSGDGVARGYLGRPDLTEEKFVPNPFAPGERMYRTGDLARWLPDGTI
EYAGRIDDQVKIRGYRVELGEIESALRHIDGVKEAAVLVRTGHSGNKELFGYMTLKPGMN
AEQVRSHLSRMLPGYMVPPYMIEMDALPLTLNGKLNRKALPEPDFTSTQSYVPPRNDLEE
QLAIIWQDVLGADRIGIEDSFFELGGDSIKALQVSARLGRCGWSLQASDLFRHPKIKDLS
PFIRKTERRIMQGPVQGDVPWTPVQRWFLSQDIKERHHFNQSVMLFHSGRLSENALRASL
QKLAEHHDALRMVYQNDGGQWIQINQGIHESQLYSLRIFNLSEAEGEWETKIKKEVADLQ
QSINLQQGPLLHAAWFKTISGDYLFLTIHHLVVDGVSWRILLEDLSTGYHQAAEGQAIQL
PPKTDSYQEYARRIQNYAQSSKLIREQAYWRIVEEQLAAELPYDIPDHENSHSRERESVS
FSLTEEDTAILLQNVNHAYGTDTQDILLTAATLAIRDWTGGKKLRIAMEGHGREDILPEL
DISRTVGWFTSMYPVLIDLENQAGDLGTAVKTVKDTLGRIPNKGVGYGMLKYITQPEHKS
ITFSKTPDISFNYLGQFNDIEKQGRFRPSGLGSGKDITHTWKREQVIEISAMAAENKLHF
QLSYPPARFHRKTMEQLISIIEHDLQEIMKHCADKQVAEKTLSDFSSQSLTAEDLDSISN
LVEEL

Enzyme Prediction     

No EC number prediction in MGYG000000227_04867.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12316	PRK12316	0.0	9	1445	2687	4099	peptide synthase; Provisional
PRK12316	PRK12316	0.0	10	1434	1645	3045	peptide synthase; Provisional
PRK12316	PRK12316	0.0	18	960	4199	5136	peptide synthase; Provisional
cd19534	E_NRPS	0.0	978	1412	1	428	Epimerization domain of nonribosomal peptide synthetases (NRPSs); belongs to the Condensation-domain family. Epimerization (E) domains of nonribosomal peptide synthetases (NRPS) flip the chirality of the end amino acid of a peptide being manufactured by the NRPS. E-domains are homologous to the Condensation (C) domains. NRPSs catalyze peptide bond formation within (usually) large multi-modular enzymatic complexes. Specialized tailoring NRPS domains such as E-domains greatly increase the range of possible peptide products created by the NRPS machinery. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). There are various subtypes of C-domains such as the LCL-type which catalyzes peptide bond formation between two L-amino acids, the DCL-type which links an L-amino acid to the D-amino acid at the end of a growing peptide, starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and heterocyclization (Cyc) domains which catalyze both peptide bond formation and cyclization of Cys, Ser, or Thr residues. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the E-domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain. C-domains typically have a conserved HHxxxD motif at the active site; mutations in this motif can abolish or diminish condensation activity.
PRK12316	PRK12316	0.0	5	1439	134	1547	peptide synthase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND46664.1	1.11e-194	12	977	1708	2674
BAZ00088.1	4.52e-164	6	966	2334	3295
BAZ75991.1	4.52e-164	6	966	2334	3295
BAY30132.1	8.22e-164	6	966	2336	3297
BAY90071.1	1.49e-163	6	966	2325	3286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P1J_A	5.24e-195	25	880	106	964	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae],6P1J_B The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo2 serine module [Eleftheria terrae]
6MFZ_A	4.56e-189	1	963	860	1797	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]
2VSQ_A	4.02e-177	6	964	103	1040	Structureof surfactin A synthetase C (SrfA-C), a nonribosomal peptide synthetase termination module [Bacillus subtilis]
6OYF_A	2.59e-171	6	794	88	873	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module [Eleftheria terrae],6OZV_A The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with AMP [Eleftheria terrae],6P4U_A The structure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with Mg and AMP [Eleftheria terrae]
6P3I_A	6.44e-165	6	794	88	873	Thestructure of condensation and adenylation domains of teixobactin-producing nonribosomal peptide synthetase Txo1 serine module in complex with Mg [Eleftheria terrae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39845	0.0	3	1445	1127	2561	Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) OX=224308 GN=ppsA PE=1 SV=2
P94459	0.0	3	1442	2163	3600	Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) OX=224308 GN=ppsD PE=1 SV=2
P27206	0.0	12	1438	2184	3583	Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAA PE=1 SV=4
Q04747	0.0	12	1444	2180	3580	Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAB PE=1 SV=3
P39846	0.0	1	1445	1128	2560	Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) OX=224308 GN=ppsB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000227_04867.