CAZyme Information: MGYG000000228_01526

Basic Information

• Species: Collinsella sp900544115
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900544115
• CAZyme ID: MGYG000000228_01526
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
823		94276.33	5.0177

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000228	2360320	Isolate	China	Asia

• Gene Location: Start: 53056; End: 55527 Strand: -

Full Sequence      

MKKYNEQCPTNERQTMRVETTGVCRGNWKIYQQLKIEGIHKGSSVTAQAATDDNRCLSLS
LLKFRDNSCDSNSYVLVIPDPDARAIKIEFSEIGQDGRTLSSDSLSLNCKNIKWESRLNY
KIKPDMCSKLRNYDDVSEFDMATIDFWQCIEDSSDYILRCTVRTPYRNDSKIKLRCLDRA
LNEVDLSIVNFGSNVTSVGFTSEKKQLETQLSIRMPKAFDRYYFVIDDQNHPSFSAFDCL
TPDKLGLLLEETNFLFTHAQFDPEYPEWFTEHKATIGALEKQRKIAFDCAPKFSIIVPLY
NTPISFFNDMAESVKSQSYANWELILVNASPDNQELKARVEQETAHDNKIKSINLTENKG
ISENTNAGVAIASGDFVCFFDHDDILEPDLLFSYAEAIENNNDVDLLYCDEDKLMPDGKL
AQPFFKPDFNIDLLRNNNYICHMLTIRKSLLDTLEPNTKEFDGAQDHNLTLRAVEKARKV
HHVAKVLYHWRLSETSTAANADSKPYATIAGIKAVQSHLDRLGLNAKVEQARRPFTYKVT
YAVPDSHPLVSIIIPTKDHADILDNCIKSIVEKSTYDNYELVIIENNSTEKATFDYYDKL
QAKYPDIVRLVTWEHEFNFSKLMNFGVAHAKSDYLLLLNNDTEVITPNWIETMLGICARE
DVGAVGAKLYYPDNTIQHAGLCVTGGVAGHLCQSMPRDNWGYFALNDAQQDFSAVTAACI
MTKRSEYEKVGGFTEELQVAFNDVDFCLKLREINDLIVYTPEVELYHYESISRGTENSTD
KRIRFHKEVAYMNYRWAKYYVEGDPYMNPNLTVEEPINRYYHL

Enzyme Prediction     

No EC number prediction in MGYG000000228_01526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	551	674	1.5e-20	0.7058823529411765
GT2	294	405	5.8e-20	0.6529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.46e-81	291	491	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	2.09e-37	552	769	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.05e-26	548	806	3	253	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	2.64e-19	294	497	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	2.65e-19	551	673	1	119	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53720.1	0.0	1	823	1	823
AZH69456.1	0.0	1	823	1	823
QOY61387.1	0.0	16	823	1	809
ACV56016.1	0.0	30	823	1	794
ACV56006.1	1.44e-205	16	823	1	829

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.23e-09	288	406	2	118	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	2.52e-128	268	814	344	891	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	6.36e-91	264	813	292	833	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P71057	3.07e-12	291	533	4	252	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q58457	1.02e-11	291	492	8	213	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q46632	3.05e-08	293	544	6	255	Amylovoran biosynthesis glycosyltransferase AmsB OS=Erwinia amylovora OX=552 GN=amsB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000228_01526.