CAZyme Information: MGYG000000229_00334

Basic Information

• Species: CAG-317 sp000433215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-317; CAG-317 sp000433215
• CAZyme ID: MGYG000000229_00334
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		46785.39	4.2892

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000229	2785689	Isolate	China	Asia

• Gene Location: Start: 343679; End: 344950 Strand: -

Full Sequence      

MPENDRINTSLPDNSAKGSLKVSLTSSLTAAPVANAKVSISYTGIPDSTLEELMTDSSGQ
TESLTLDAPPLEYSLDPAFDEQPYSEYTLRIEAEGYAPISVAGAEVLAATLSLQNLALAP
LGAENNDSVYVIPAHTLYGEYPAKIPEEEIKPVQESGEIVLSRVVVPEYIVVHDGSPRDS
TAKNYYVKYKDYIKNVASSEIYATWPAATIRANVLAIMSFTLNRVYTEWYRNQGYDFTIT
SSTAFDHKWIPNRNIFDSISVVVDELFADYLSRPNVKQPILTQYCDGRQVQCPNWMTQWG
SKSLGDQGYTPIEILRYYYGDDMYINTAEAISGVPASWPGYDLSVGSSGDKVRQMQEQLN
VIAGAYPALPKVDADGIYGTATENSVRKFQSIFNLPQTGVVDYKTWYKISEIYVGVSRIA
ELT

Enzyme Prediction     

No EC number prediction in MGYG000000229_00334.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	3.67e-13	348	409	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	1.60e-07	343	409	39	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	2.86e-06	339	409	117	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
pfam13620	CarboxypepD_reg	8.53e-04	31	118	12	81	Carboxypeptidase regulatory-like domain.
TIGR02669	SpoIID_LytB	0.004	296	319	237	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50293.1	1.58e-237	15	423	10	419
QEI32542.1	4.77e-237	17	422	23	429
QHB25032.1	4.77e-237	17	422	23	429
QRT31086.1	2.96e-236	17	422	25	431
QUO33025.1	8.38e-228	15	422	9	417

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000229_00334.