CAZyme Information: MGYG000000229_01656

Basic Information

• Species: CAG-317 sp000433215
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-317; CAG-317 sp000433215
• CAZyme ID: MGYG000000229_01656
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
445	MGYG000000229_6|CGC1	51438.1	9.1836

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000229	2785689	Isolate	China	Asia

• Gene Location: Start: 122109; End: 123446 Strand: +

Full Sequence      

MKNKRAVIVFTRVPVPGKTKTRLMPYFTPKQCEQVHICLLKDMKRECEQATADIFVCYTP
EDKEKKIRKIFGKEAKYFPQKGENLGVRMYVAIKDILKMGYDSCILFGTDIPELHSTDME
NAFRILETKDIVFGPTEDGGYYLVGMNEPHKEVFEKQSYGHASVMENTLAGLKEVGLQVG
FIRELSDIDRKEDVIAFRQKMRENSKLQKTQTGKYLMRTTKISIIIPIYNEETTILAMKR
QMEGLKDKCEVIFVDGGSTDRTLELLGDTFPVYHSDKGKAAQMNVGAKNSHGDILCFLHC
DSEIPVTLVPEIRYVMKDHQAGCFGIAFHSKNFFMWTCRVISNHRIKDRKVMFGDQGIFV
TRELFFEAGMFAELPILEDYQFSLTLKEKGIRLGMARHRIYTSDRRFPDGIIPKLKLMWL
MNRLRKMYRDGVPIEKIASLYKDVR

Enzyme Prediction     

No EC number prediction in MGYG000000229_01656.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	223	337	2.3e-16	0.7294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04283	glyco_like_mftF	4.24e-86	222	441	1	220	transferase 2, rSAM/selenodomain-associated. This enzyme may transfer a nucleotide, or it sugar moiety, as part of a biosynthetic pathway. Other proposed members of the pathway include another transferase (TIGR04282), a phosphoesterase, and a radical SAM enzyme (TIGR04167) whose C-terminal domain (pfam12345) frequently contains a selenocysteine. [Unknown function, Enzymes of unknown specificity]
TIGR04282	glyco_like_cofC	1.86e-80	7	193	1	188	transferase 1, rSAM/selenodomain-associated. Members of this protein family show strongly correlated phylogenetic distribution, and in most cases co-clustering, with an unusual radical SAM enzyme (TIGR04167) whose C-terminal pfam12345 domain often contains a selenocysteine residue. Other members of the conserved gene neighborhood include another putative glycosyltransferase, an alkylhydroperoxidase family protein (TIGR04169), and a phosphoesterase family protein (TIGR04168). The cassette is likely to be biosynthetic but its exact function is unknown. [Unknown function, Enzymes of unknown specificity]
cd02522	GT_2_like_a	1.24e-60	222	441	1	221	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam09837	DUF2064	6.86e-25	52	161	10	120	Uncharacterized protein conserved in bacteria (DUF2064). This family has structural similarity to proteins in the nucleotide-diphospho-sugar transferases superfamily. The similarity suggests that it is an enzyme with a sugar substrate.
COG3222	COG3222	3.55e-24	7	194	7	197	Uncharacterized conserved protein, glycosyltransferase A (GT-A) superfamily, DUF2064 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET56509.1	1.08e-207	4	445	2	445
QRP38681.1	9.54e-206	4	445	2	443
ASN96524.1	9.54e-206	4	445	2	443
QJU19226.1	5.49e-205	4	445	2	443
QIX90246.1	1.82e-203	4	445	2	443

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CGX_A	2.63e-20	3	212	3	215	ChainA, Putative nucleotide-diphospho-sugar transferase [Oleidesulfovibrio alaskensis G20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48214	3.91e-07	222	389	2	184	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2
Q92IF9	7.51e-06	213	330	286	423	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000229_01656.