CAZyme Information: MGYG000000230_00297

Basic Information

• Species: Lactococcus petauri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus petauri
• CAZyme ID: MGYG000000230_00297
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
978	MGYG000000230_1|CGC6	113536.98	6.2547

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000230	1982297	Isolate	China	Asia

• Gene Location: Start: 312251; End: 315187 Strand: -

Full Sequence      

MNDKVSVVVTCYNHEKYIAKCIKSIFEQTYQNIELIVFNDGSTDCSGEIISSLLLESPFK
ETKYFSGANQGVVKVRNAALEQITGEYLLFVDSDNFLSKDYVEILLKEAKKHGDADIAYC
QLWDFEKKRNILHDNLDFILEDELVQNVIDMSSLVKTTAIKSAKFDENLKSLEDYDFWLN
LILKNGAKAFFVRETKLNYRVLDASRSQRDDLNRYFEDYLYILKKYKPLLGDKYDQAIKQ
SLISTSHNFREMNRLAEERLLLIRDLEKVLHYNEQQLQVKEEQLQNLIQSRSYKLGNFII
HNTKRTLFVLKRPKLLVKAPRKIYRKLSLNFHPLLEMRKALLRPLRNKARAKNNYHNPQR
ALVYVVYADGKKLQEYKIIFLEALAKLSHEIIIVVNGSLIPEDKTILETYGRVDIRPNKG
YDTAAFRHGILAFANESLSHFDELLLVNDTNVGPFIDLEKIFEKMASQKLDFWGMSYGEP
QPDITGYNKYKTIPIHLQSYFLVIEKSMFTYSGFIKYWENMNDTDSRDKAIGKHETVFTK
HFEYLGFKHGAVSNNNSDSAMYIHPLTMLKDFDVPLVKYTAFSNYSDDKFLWQGISRKTQ
VPELIEYIKTNTTYPAHVIDKMMEDIKTSAPKEHILIIDGVENAIPQCTRYRVENKAAQL
RELGYDVLTVNASAFKMSDAENASHIVIYRTGYSEVLEQLCHLAKKYNKPVYYDIDDLVI
DTKYTDLLAYTQGLSEVDKYNYDSSVKSYGKMMALCDIVVTTTQTLKEELENYSSEVIIN
RNLASEELVRLSQETLKDYTQVSSKIKIGYFSGSITHNENFEMIKPAIMQILEKYPHVEL
HLVGYIDLPQDLKKYTEQIIMNDYVDWKELPRLISQMDINLAPLVDSVFNRAKSEIKWLE
AALVKVPTVASYLGSFEEMVKNDETGILAQPDEWYEKLETLIENPSKRQTIAENAYYFVL
ENCTIKEHTDEFTKSISI

Enzyme Prediction     

No EC number prediction in MGYG000000230_00297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	138	4e-27	0.7705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05045	RgpF	1.75e-47	391	658	1	273	Rhamnan synthesis protein F. This family consists of a group of proteins which are related to the Streptococcus rhamnose-glucose polysaccharide assembly protein (RgpF). Rhamnan backbones are found in several O polysaccharides of phytopathogenic bacteria and are regarded as pathogenic factors.
cd03794	GT4_WbuB-like	1.86e-34	631	964	46	382	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
COG3754	RgpF	3.97e-32	360	631	3	269	Lipopolysaccharide biosynthesis protein [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	1.99e-31	7	191	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	5.06e-26	6	141	1	134	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR10899.1	0.0	1	978	1	978
QSR12508.1	0.0	1	978	1	978
QSR02202.1	0.0	1	978	1	978
QSQ98355.1	0.0	1	978	1	978
BAV02597.1	0.0	1	976	1	976

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	7.14e-18	3	129	5	128	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
6P61_A	9.98e-15	5	176	15	178	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
2Z87_A	1.11e-14	5	260	376	624	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	1.12e-14	5	260	377	625	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
3L7I_A	1.71e-14	3	290	2	302	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URH7	1.18e-22	1	162	3	162	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
Q57022	1.82e-19	5	182	6	183	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
A0A0H2UR96	1.17e-18	1	150	1	151	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q92IF9	7.57e-17	1	186	290	478	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q4UM29	6.95e-16	2	186	292	478	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000230_00297.