CAZyme Information: MGYG000000230_00623

Basic Information

• Species: Lactococcus petauri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus petauri
• CAZyme ID: MGYG000000230_00623
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
365	MGYG000000230_2|CGC3	41288.31	5.4936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000230	1982297	Isolate	China	Asia

• Gene Location: Start: 216002; End: 217099 Strand: -

Full Sequence      

MEETLYIVVMIPAWNEAGSIGEAVSSIYEQTRLPDRIFVVPNNTTDLTSVEAMAAGAEVL
VMPGKNEKKKAGALNWALEKLSPTLDAQRSAVLVMDADTMIEPDFIEKAEKKMIEEARVG
GVSSIFVGRNSTNLLGILQQMEFARFARLVHKRAEVYVLSGTASLISWDVLKEIKGARLE
AKLLPEGESYYDVDSMTEDNELTLAILVLGFSVPHVGVKSITDVMEDYNSLYHQRKRWYI
GALQNIKEYGRKMPPWMRMIYWVQQIGLYMALAITPIVLFAFTIYLIQVVLSEGAVLGWS
RITSIVLLILYLFVQVTTVWDQGWKCRLVALSYFPEIVYAIFLLIFYAAALWSFLTGKDM
KWKHT

Enzyme Prediction     

No EC number prediction in MGYG000000230_00623.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	8	241	1.1e-20	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	9.23e-37	9	199	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.35e-26	7	365	56	416	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06438	EpsO_like	4.28e-22	9	202	1	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
pfam13641	Glyco_tranf_2_3	2.26e-14	9	239	6	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06435	CESA_NdvC_like	1.91e-13	37	249	31	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR12288.1	7.14e-260	1	365	7	371
QSR04347.1	2.05e-259	1	365	7	371
QSR01954.1	8.33e-259	1	365	7	371
QSR10673.1	4.82e-258	1	365	7	371
AOT56537.1	2.87e-172	2	365	67	434

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
268	290
297	319
334	356