CAZyme Information: MGYG000000230_01037

Basic Information

• Species: Lactococcus petauri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus petauri
• CAZyme ID: MGYG000000230_01037
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		50193.78	8.5337

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000230	1982297	Isolate	China	Asia

• Gene Location: Start: 17270; End: 18577 Strand: -

Full Sequence      

MVAWFNLSSIVDITLFIFIFYPIVGGIFWIIGSTYYHFRTKKCLPKFPEDAEEPFITIMV
PCHNEEVVIKRTLHYLDTQINYKNYEIIAISDGSTDNTNTILREWQETKSNSHLRVIEVQ
KNKGKAHGLTQAALHSKGDFLLCIDADSFVTGNALKHMVAWFMIDSIFSPKELVAAVTGN
PMPRNLTSLLAKLQYVEYHSIIGMTKRAQSMIGRIFTVSGVCVMYRREALIDIGLFDQSK
ITEDIAVSWALQLKGWRIQYAPNARCYMEVPEKISVLYKQRRRWAQGGLEVFMSHALDVL
LHPVKTFPFIFLLMDQFLSIMWAIFWFISSLFVIYWLFFWVALGDGFQIKRFIISALIFI
MYEFIVGVTQLLTSIWFNESDKAAMKYSLFAGWYTWIYWLISPFTLLAALPRAIKAQITG
GGGTWVSPERQKTED

Enzyme Prediction     

No EC number prediction in MGYG000000230_01037.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	54	285	1.4e-34	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11204	PRK11204	5.33e-129	15	430	10	416	N-glycosyltransferase; Provisional
PRK14583	hmsR	3.67e-76	12	430	28	437	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
COG1215	BcsA	4.21e-64	13	419	10	412	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	1.58e-60	58	244	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06439	CESA_like_1	9.52e-37	17	289	1	249	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR11550.1	0.0	1	435	1	435
QSR03391.1	0.0	1	435	1	435
BAV01948.1	1.60e-290	1	435	1	435
QBO36112.1	1.77e-152	6	434	16	441
QYU57469.1	2.15e-126	5	435	7	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.04e-10	56	158	7	105	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
6P61_A	4.40e-10	54	244	13	175	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q99QX3	4.30e-76	19	434	8	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1
Q6GDD8	4.30e-76	19	434	8	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	4.30e-76	19	434	8	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q5HCN1	4.30e-76	19	434	8	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q9RQP9	4.30e-76	19	434	8	411	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000079	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	32
291	313
318	340
352	374
389	411