CAZyme Information: MGYG000000230_01263

Basic Information

• Species: Lactococcus petauri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus petauri
• CAZyme ID: MGYG000000230_01263
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477	MGYG000000230_6|CGC1	55835.02	6.3656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000230	1982297	Isolate	China	Asia

• Gene Location: Start: 81966; End: 83399 Strand: -

Full Sequence      

MKIEFPKDFWWGAATSGPQTEGRFKKKHDNVFDYDFDHFSERFWGSIGPDNASNFYNDFE
EDIRLMQKAGLNSIRTSIQWSRLIEDFETGKTNPQAVAFYNRVIDTFLAAGIRPMMNLHH
FDLPVELLHKYGGWENKKVALLFAQFAEQCFRLFGDRVTEWFTHNEPIVVVECGYLLGFH
YPDLKDGKKAVQVAYNLQLASSLAIERFRKINKNAQAQIGIILNLTPNYAKDEEIQNLRA
AHFADLWQNQLFLDASVKGHFPQELVNILERDGVLWESTTEELEVIKHNTVDFLGVNYYH
PSRVQEPEFSSDSLAQDWLPEKYYASFNKRGVRMNADRGWEIHPQTIYKIAKTIQKDYNN
IPWFISENGMGVENEARFEDTSGVIQDDYRIQFMTEHLYYLHQAMVEGSACLGYHTWTPI
DCWSWRNSYKNRYGLISLDIHRKIKKLKKSAHWYRKVSESSSVDIEEALLQKLKEDK

Enzyme Prediction     

No EC number prediction in MGYG000000230_01263.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	461	1.8e-131	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	5	460	4	452	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	4.50e-118	1	460	1	450	Glycosyl hydrolase family 1.
PRK13511	PRK13511	9.96e-92	1	460	1	465	6-phospho-beta-galactosidase; Provisional
PRK15014	PRK15014	8.94e-61	2	461	3	473	6-phospho-beta-glucosidase BglA; Provisional
PRK09852	PRK09852	1.29e-60	5	466	4	474	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR11732.1	0.0	1	477	1	477
QSR01277.1	0.0	1	477	1	477
QSR03570.1	0.0	1	477	1	477
QSR13407.1	0.0	1	477	1	477
QSQ97435.1	0.0	1	476	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NAV_A	1.33e-199	3	459	18	473	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	3.81e-199	3	459	18	473	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
4B3K_A	6.29e-196	3	458	1	456	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	6.51e-196	3	458	2	457	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
6Z1H_A	2.06e-102	3	466	9	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	6.72e-157	2	461	6	463	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P26208	3.11e-85	2	457	3	442	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
Q97EZ2	9.23e-77	5	458	4	461	6-phospho-beta-galactosidase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lacG PE=3 SV=1
Q08638	3.07e-73	4	464	5	445	Beta-glucosidase A OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bglA PE=1 SV=1
B9K7M5	1.14e-72	4	463	3	442	1,4-beta-D-glucan glucohydrolase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=gghA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000230_01263.