CAZyme Information: MGYG000000231_01706

Basic Information

• Species: Coprococcus eutactus_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus eutactus_A
• CAZyme ID: MGYG000000231_01706
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		40161.52	4.3812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000231	3050336	Isolate	China	Asia

• Gene Location: Start: 560302; End: 561354 Strand: +

Full Sequence      

MKKQIKVTLIVIVAAIIAAAIIWYVMYLRGKEQDLLTPVGTRAEFIGDTDKYPTMLTAKG
TQILNADGEQVVLKGVMVPESRSLYEEKKFNEDFYKDVFAKGGNAIRVPISPVEYKNDDY
YMWRYLDRIVTWAGENDNYVILDWDYTGNPIDGSGDEMPDLDENPLDYSAEFWKNIADYF
KNTPNVIFEIYNEPVGMSDSEWKRCAESLIGVIRDAGAKQLIIVGSPDYCYDLGWLDELG
VKNDNTAFSVHVYPDKVFWQKFLSGYVTSYPLIVTEWGYADDDVEVKNEKLKGTRNVFGI
KFTRYLEKHDIGWIAVGYDDTVEPSMFTKGYKKLTKWGEYVTELLGDKEE

Enzyme Prediction     

No EC number prediction in MGYG000000231_01706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	62	333	3e-42	0.8909090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.52e-32	64	314	1	264	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.51e-09	92	291	76	305	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83512.1	1.41e-266	1	350	1	350
QTA37905.1	1.59e-90	1	345	1	349
AEW47956.1	2.40e-75	52	341	55	346
AZR73456.1	9.85e-59	140	345	1	208
QFU77336.1	1.66e-31	56	340	73	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HTY_A	5.28e-26	55	328	51	336	CrystalStructure of a metagenome-derived cellulase Cel5A [uncultured bacterium],4HU0_A Crystal Structure of a metagenome-derived cellulase Cel5A in complex with cellotetraose [uncultured bacterium]
3PZT_A	1.87e-19	56	337	37	308	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
5ECU_A	4.90e-13	133	325	108	299	Theunliganded structure of Caldicellulosiruptor saccharolyticus GH5 [Caldicellulosiruptor saccharolyticus]
1EGZ_A	7.86e-13	126	345	79	284	ChainA, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_B Chain B, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_C Chain C, ENDOGLUCANASE Z [Dickeya chrysanthemi]
5WH8_A	1.03e-12	56	329	14	284	CellulaseCel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	2.45e-18	56	349	42	334	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	3.30e-18	56	337	42	313	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	4.79e-17	56	349	42	334	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P22541	1.80e-15	51	283	111	341	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P07103	9.05e-12	126	345	122	327	Endoglucanase Z OS=Dickeya dadantii (strain 3937) OX=198628 GN=celZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997334	0.001907	0.000433	0.000013	0.000007	0.000336

TMHMM  Annotations     

start	end
7	26