CAZyme Information: MGYG000000231_01740

Basic Information

• Species: Coprococcus eutactus_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus eutactus_A
• CAZyme ID: MGYG000000231_01740
• CAZy Family: GH53
• CAZyme Description: Arabinogalactan endo-beta-1,4-galactanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000000231_2|CGC7	46655.69	4.4091

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000231	3050336	Isolate	China	Asia

• Gene Location: Start: 597427; End: 598659 Strand: +

Full Sequence      

MKMNWYIRSMQNIFLRRLFLVITGSKINAGEGDKNMADYIKGVDLSAVVEVEELGAKYYD
NGVQGDIFDILKNYGVNSVRLRLWNDPYTEDGVPYGAGTNDLEVYKKLAKRAMDHGMSIL
LDYHYSDFWADPGKQRVPKAWRGMDADQLEQAVYDYTRETLLDMKDAGVLPQLVQVGNEL
TNGLMWPLGQKPEYDNIAKFVSAGIRAVRSVDSDIPVMIHLDNGGNNPMYVDWFDHYMER
GEDFDIIGMSYYPFWHGTMKELEANMRDMADRYGKKIVIAEVSMGFTMEDYADYEKLGPD
DRKGYATKPSLVEKLDYPMTPEGQAEFMNDIMKLIDDVPGGDGFYYWEAGWIPVPGSGWA
TEGALSYIEESGPCGNEWANQALFDYDGHALPALKTIRDYKPLHSDYPLK

Enzyme Prediction     

No EC number prediction in MGYG000000231_01740.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	40	396	4.7e-135	0.9941520467836257

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3867	GanB	7.86e-146	37	395	37	389	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	1.30e-139	40	396	1	332	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83542.1	1.80e-313	1	410	1	410
AEN97298.1	5.63e-178	39	402	3	368
CBK91326.1	1.20e-174	36	401	1	368
ACR75146.1	1.20e-174	36	401	1	368
QNM01586.1	1.39e-173	36	401	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	8.78e-96	38	398	49	392	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	1.10e-91	38	398	23	389	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	8.76e-91	38	398	23	389	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
4BF7_A	6.51e-56	41	365	22	331	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJS_A	1.14e-54	41	398	5	330	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q65CX5	1.27e-90	38	398	48	414	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
P48843	2.80e-86	39	398	6	347	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
O07013	4.03e-84	38	398	52	418	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
Q9Y7F8	4.08e-57	41	358	21	324	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
Q8X168	8.70e-56	41	352	21	318	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.980154	0.019595	0.000128	0.000050	0.000029	0.000050

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000231_01740.