CAZyme Information: MGYG000000231_01824

Basic Information

• Species: Coprococcus eutactus_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus eutactus_A
• CAZyme ID: MGYG000000231_01824
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000000231_2|CGC10	45068.21	3.9753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000231	3050336	Isolate	China	Asia

• Gene Location: Start: 704933; End: 706183 Strand: +

Full Sequence      

MKKAIVLLIVMVCLAAGIWGIFMLRGSAGKAGDHVENDNGNTGVAADVTESGTTTEEQTA
DSQETTEVTEEEKPSLVDETLAGMTLHEKVCQMMFVTPEELTGEDGVTVAGDATRQALEN
YPVGGIVYFAKNLESQDQVKEMIDNSQKYSSIGLFVATDEEGGVVNRLMDTVGTTYIGSM
YYYKDDGDETAYENAYTIANDMSALGFNLDFAPVADVWSNPDNTVIGERAYSDDYAQAAE
LVGNAVKGFNDGGVMCTLKHFPGHGDTAEDSHYSSAYVHRTKEEIMADEMQPFRSGIEAG
AEFVMVGHLIVPDIDEVPATLSYKIATGILRDELKFEGVAITDSFEMESIADNYSVDDAV
VMSVKAGMDMILQPKDMASAVNSIEQAVADGELSEDRIDESVRRILTLKESRGLLK

Enzyme Prediction     

No EC number prediction in MGYG000000231_01824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	147	372	9.1e-53	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	2.51e-80	84	416	1	319	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	6.20e-80	85	408	1	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	8.80e-53	100	372	12	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.19e-17	73	416	34	360	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83616.1	5.08e-282	1	416	1	416
ADU24128.1	3.92e-128	73	415	106	452
CBL36844.1	2.63e-96	2	414	60	498
CBK77067.1	1.04e-95	2	414	60	498
QJU16873.1	1.92e-92	74	409	92	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BMX_A	1.55e-68	84	414	42	398	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
6K5J_A	2.50e-68	84	414	11	342	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3LK6_A	5.00e-68	84	414	16	372	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	9.19e-68	84	414	46	402	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
4ZM6_A	1.61e-47	118	410	34	338	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	8.47e-68	84	414	42	398	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	9.19e-47	116	409	57	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
Q5QUZ5	6.81e-42	93	406	5	306	Beta-hexosaminidase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) OX=283942 GN=nagZ PE=3 SV=1
L7N6B0	4.86e-39	106	409	72	380	Beta-hexosaminidase LpqI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lpqI PE=1 SV=1
A0A0H3M1P5	1.30e-38	106	409	72	380	Beta-hexosaminidase LpqI OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=lpqI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.899706	0.094562	0.004200	0.000526	0.000249	0.000769

TMHMM  Annotations     

start	end
5	22