CAZyme Information: MGYG000000231_02066

Basic Information

• Species: Coprococcus eutactus_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus eutactus_A
• CAZyme ID: MGYG000000231_02066
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		95341.39	9.5042

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000231	3050336	Isolate	China	Asia

• Gene Location: Start: 17715; End: 20297 Strand: +

Full Sequence      

MIIRKFTRIILGAALGISVFAFAGNVPETAYAADMSDISVTSTREDVQQVVDDGNFHYTE
LDGTEIDHIYELYNNDPETIKQLQRQSDYNATGDIATLSAGYTHSSMFDGYKVIKGIDVS
EWNGDSINWKKVKAAGISYAFIRVGGRYYGSGKYFIDSTYKDNIKNALNAGVDVGVYFYS
QAISTSEAKTEAKYTTDLISGYNITYPVVMDYEYAWEDGGLSGRLYNAHLSKSAATNVIK
AFCAAVESKGYVGMIYASKTVITDDMNASSIAQSYPIWNAQYNDTDTLTVKHSYWQYSDV
GKVSGISNATDMNFRYVKSPAAPSSLTQSACTDSTITLTWTKIPEVYAYQIVRYDSSEDK
YVSVGTAKGAGTTTFTDKNLQDGKKYTYKVRGYYKLSSGAIYGTYSAECTGITIADTIEN
FAATVTAPTSVKLSWSPIPAATGYRVYRSNGSSGSYETIATTNSPDDCEVTDSQLNPGTK
YNYKVRAYTTTDTNTIWHVLSDAKTITTDPGEVTGLKITSAYTSSLTLKWNKQENVDGYI
VYVWEPSNATWTRLAKISSKSTDTYTHKGLPHSTEYSYTVCAYYKKNGTYHYTETASAAS
GFTGPAVPSQIATASRTANSVTIRWTQISDATGYTVYKYNTSSKSFEQVARISGSSNRTY
TFTGLKAGTEYKFGVRAYTERNGFTGFSDRKDFSSCTLPATFTSSFKYTPLGSQRFLQWS
KLSYADGYIVYKYDQKANKYTRVKKITSNKTNFCFVPNLRRGYGYRVLAYMKYNGKIYYG
ALSKAPIKNTSLTGTITDSSVNLRAKAGTNSRVVRTLARGSKVKISGYAKSGRYIWYKVT
YTRGSRKYTGYIRSDLIRVK

Enzyme Prediction     

No EC number prediction in MGYG000000231_02066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	117	306	2.5e-43	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	6.78e-72	114	316	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	3.31e-31	115	313	1	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	1.17e-26	117	306	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	1.67e-26	115	314	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	7.63e-22	113	313	62	251	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82808.1	0.0	1	860	1	860
CBK82807.1	4.81e-117	1	288	1	289
CCO05379.1	5.21e-88	3	788	4	846
QNL98623.1	3.52e-57	101	316	35	251
BAK47549.1	2.20e-49	102	561	191	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	6.57e-13	114	313	5	200	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
5A6S_A	2.32e-09	152	314	54	200	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]
5J7K_A	2.95e-06	605	677	2	72	Loopgrafting onto a highly stable FN3 scaffold [synthetic construct],5J7K_B Loop grafting onto a highly stable FN3 scaffold [synthetic construct],5J7K_C Loop grafting onto a highly stable FN3 scaffold [synthetic construct],5J7K_D Loop grafting onto a highly stable FN3 scaffold [synthetic construct],5J7K_E Loop grafting onto a highly stable FN3 scaffold [synthetic construct],5J7K_F Loop grafting onto a highly stable FN3 scaffold [synthetic construct],5J7K_G Loop grafting onto a highly stable FN3 scaffold [synthetic construct],5J7K_H Loop grafting onto a highly stable FN3 scaffold [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	1.13e-11	114	313	82	277	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	3.27e-10	114	313	9	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P50899	6.96e-09	403	720	695	1021	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000352	0.998881	0.000197	0.000203	0.000173	0.000151

TMHMM  Annotations     

start	end
9	31