CAZyme Information: MGYG000000231_02067

Basic Information

• Species: Coprococcus eutactus_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Coprococcus; Coprococcus eutactus_A
• CAZyme ID: MGYG000000231_02067
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
690		76500.71	9.4016

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000231	3050336	Isolate	China	Asia

• Gene Location: Start: 20468; End: 22540 Strand: +

Full Sequence      

MRIKRLSKQLFIISLGIFILTAADNIFHSATVYAADTSTISTSSTRSEVQEVVDEGNFDY
TQLSDAEIDHIYSLYGNDPETIRQLQKQSDSANPYGVATLSSTTYTHASQFKNSTVMKGI
DVSEWNGSINWSKVKSSGVTFAFIRAGGRYYGSGAYFVDSKFAENVKNATAAGIDVGAYF
YSQAINATEARQEAAYTLNIVSSYNLTLPIVMDYEYAWEGGLTGRLYNAHLSKSAATTVI
NTFCSTVEASGYVGMLYASKSVITDDMNITSINNKYPIWNAQYNDSDTLTATHSYWQYDD
NGTVAGISYPTDLDFKYVNTPAAPTELTFKSSTSSSITLTWNKVPEVYGYQIVRYDEAEG
KYVSIGTTKGAGTLTYTDNGLTSGKKYTYMVRGYHKLNTGTVFGAYSQEYSCTATYAEAV
TASTDPEPPIFDTAPDMPTQAAIADRTSSSINVRWSKISGVTGYFVYKYNTSTGKYDRIA
RCIGDESRSYNFTGLSPATTYKFGVRAYYEYNGVIMYSNRLEFSKCTKPRTFTSSFKYTP
LGSYRCLHWQKLSNVSGYIIYKYDIAHNKYTRVKKIFSYKTTSCILPALKSGFGYRILAY
KNVNGSIVYGDISKAPAKASSLSGTVIDSQVRLRAGAGTNKRIIRELARGSKVKISGCKY
SGKNAWYKITYTKGSKKYTGYVRSDFIRIN

Enzyme Prediction     

No EC number prediction in MGYG000000231_02067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	120	307	2.6e-47	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	1.03e-72	117	317	1	191	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	9.84e-39	118	314	1	184	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	4.91e-32	120	307	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	1.60e-27	118	315	1	183	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06413	GH25_muramidase_1	1.31e-25	118	313	4	186	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82808.1	1.79e-269	1	689	1	859
CBK82807.1	2.61e-193	1	289	1	289
QNL98623.1	1.10e-61	105	317	36	251
CCO05379.1	4.53e-59	32	629	24	597
BAK47549.1	1.73e-49	82	537	168	672

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	1.01e-16	117	323	5	207	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	1.70e-11	117	314	20	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WW5_A	3.36e-11	118	317	270	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae at 1.6 A resolution [Streptococcus pneumoniae R6],2WWD_A 3D-structure of the modular autolysin LytC from Streptococcus pneumoniae in complex with pneummococcal peptidoglycan fragment [Streptococcus pneumoniae R6]
4KRT_A	6.32e-11	117	314	20	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
2WWC_A	7.77e-11	118	317	270	468	3D-structureof the modular autolysin LytC from Streptococcus pneumoniae in complex with synthetic peptidoglycan ligand [Streptococcus pneumoniae R6]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25310	2.09e-15	117	323	82	284	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	2.39e-11	112	314	4	194	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P34020	6.57e-11	117	314	1	178	Autolytic lysozyme OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=lyc PE=1 SV=1
P50899	5.86e-08	237	507	696	963	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1
P76421	2.60e-07	114	314	64	252	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001409	0.996728	0.001274	0.000223	0.000174	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000231_02067.