CAZyme Information: MGYG000000235_00573

Basic Information

• Species: Enterobacter kobei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter kobei
• CAZyme ID: MGYG000000235_00573
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146	MGYG000000235_2|CGC2	16558.04	8.4067

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000235	4917845	Isolate	China	Asia

• Gene Location: Start: 118196; End: 118636 Strand: -

Full Sequence      

MKKLIFLLLIISQSALANCWDKAAHYYHVDPYLLYAIANVESGMNPYAVGRNHDGTRDVG
LMQINSSHFSALESRGIDEYRLITEPCTSIMVGASILSSMIKVYGYNWEAVGAYNAGLKK
ENYPQRMIYAHKVWKKYQELKATANE

Enzyme Prediction     

No EC number prediction in MGYG000000235_00573.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	27	142	1.4e-23	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	2.79e-91	1	146	1	148	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	3.63e-51	27	138	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.60e-29	20	118	1	96	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	7.84e-24	1	143	1	148	lytic transglycosylase; Provisional
cd00254	LT-like	1.49e-15	31	138	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB81505.1	1.48e-103	1	146	1	146
QIP19496.1	1.48e-103	1	146	1	146
QZS48750.1	1.48e-103	1	146	1	146
BBV70441.1	1.48e-103	1	146	1	146
BBS31439.1	1.48e-103	1	146	1	146

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	7.52e-11	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	6.51e-44	4	146	6	148	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	6.51e-44	4	146	6	148	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	3.73e-43	4	146	6	148	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q55287	2.05e-33	1	146	1	147	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	8.26e-33	1	146	1	147	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001362	0.992385	0.005560	0.000232	0.000223	0.000231

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000235_00573.