CAZyme Information: MGYG000000235_02416

Basic Information

• Species: Enterobacter kobei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter kobei
• CAZyme ID: MGYG000000235_02416
• CAZy Family: GH73
• CAZyme Description: Peptidoglycan hydrolase FlgJ

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000000235_8|CGC5	34725.38	9.2552

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000235	4917845	Isolate	China	Asia

• Gene Location: Start: 144512; End: 145465 Strand: +

Full Sequence      

MLTDSKLLTSAAWDAQSLNELKTKAGKDPAANIRPVARQVEGMFVQMMLKSMRETLPKDG
MFSSDSTRLYTSMYDQQIAQQMTAGKGLGLADMIVKQTEAAQGIQPKDEPQQVPMKFDLQ
TVTSYQNQALTQMVRKAIPKATVSSDEPLSGDSKDFLAQLSLPARLASEQSGVPHHLILA
QAALESGWGQRQIRKENGDPSFNIFGVKATSSWKGPTTEITTTEYENGAAVKVKAKFRVY
SSYLEALSDYVGLLSRNPRYTAVTQAATAEQGAQALQNAGYATDPNYARKLTSMIQQLKS
MGEKVSKAYSTDIENLF

Enzyme Prediction     

No EC number prediction in MGYG000000235_02416.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	166	298	5e-34	0.9296875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05684	flgJ	6.80e-179	2	313	1	312	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	1.19e-131	11	299	1	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.
PRK12709	flgJ	2.70e-75	12	298	15	319	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12712	flgJ	2.08e-73	12	300	17	344	flagellar rod assembly protein/muramidase FlgJ; Provisional
PRK12713	flgJ	2.07e-70	11	300	15	328	flagellar rod assembly protein/muramidase FlgJ; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBW21318.1	1.74e-223	1	317	1	317
BBV70653.1	1.74e-223	1	317	1	317
AYL05953.1	1.74e-223	1	317	1	317
AOP86383.1	1.74e-223	1	317	1	317
QIP19706.1	1.74e-223	1	317	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DN4_A	8.17e-99	152	317	2	167	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN5_A	1.09e-90	152	301	2	151	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	2.49e-36	164	295	12	143	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	3.24e-36	164	295	13	144	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	2.50e-35	164	295	13	144	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15931	5.90e-186	1	317	1	316	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1
P75942	9.35e-173	1	317	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1
P58231	3.11e-171	1	317	1	313	Peptidoglycan hydrolase FlgJ OS=Escherichia coli O157:H7 OX=83334 GN=flgJ PE=3 SV=1
Q9X9J3	1.81e-47	14	301	13	308	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
Q9I4P4	9.19e-45	14	300	20	387	Peptidoglycan hydrolase FlgJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000235_02416.