CAZyme Information: MGYG000000236_00308

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_00308
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	MGYG000000236_1|CGC3	34377.19	9.5922

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 335393; End: 336286 Strand: +

Full Sequence      

MDTFIQITDFILFLCFSLFTIYLGIPAVAASLKNATRYPKTGKKHRFAILFPTDTPFSFS
PDYPEELYKVFTYEDLTETVGTLDEKDFDAVIILGKTTRIEPAFLNEINKAFDGGARAIQ
LHPITENRSTRKQYFQALNEEINHSFFRKGAIRLGVSSALCGTDMVLDLAWLKKNQKSRK
SNLERRLVRQGIFVEYLETVKVYSNDIRIPQYKVRFSKALSALPEAMLTAHWDYCNKIFR
WVLPSWRTGLTAIFFIAILLLCYNWTLSLKWWALLYVLIFIVCLAIPDYLVGQKTKK

Enzyme Prediction     

No EC number prediction in MGYG000000236_00308.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	7.81e-05	87	175	81	170	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
pfam13641	Glyco_tranf_2_3	1.55e-04	87	204	87	211	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd14678	PH_DOK4_DOK5_DOK6	0.001	33	76	58	104	Pleckstrin homology (PH) domain of Downstream of tyrosine kinase 4, 5, and 6 proteins. The Dok family adapters are phosphorylated by different protein tyrosine kinases. Dok proteins are involved in processes such as modulation of cell differentiation and proliferation, as well as in control of the cell spreading and migration The Dok protein contains an N-terminal pleckstrin homology (PH) domain followed by a central phosphotyrosine binding (PTB) domain, which has a PH-like fold, and a proline- and tyrosine-rich C-terminal tail. The PH domain binds to acidic phospholids and localizes proteins to the plasma membrane, while the PTB domain mediates protein-protein interactions by binding to phosphotyrosine-containing motifs. The C-terminal part of Dok contains multiple tyrosine phosphorylation sites that serve as potential docking sites for Src homology 2-containing proteins such as ras GTPase-activating protein and Nck, leading to inhibition of ras signaling pathway activation and the c-Jun N-terminal kinase (JNK) and c-Jun activation, respectively. There are 7 mammalian Dok members: Dok-1 to Dok-7. Dok-1 and Dok-2 act as negative regulators of the Ras-Erk pathway downstream of many immunoreceptor-mediated signaling systems, and it is believed that recruitment of p120 rasGAP by Dok-1 and Dok-2 is critical to their negative regulation. Dok-3 is a negative regulator of the activation of JNK and mobilization of Ca2+ in B-cell receptor-mediated signaling, interacting with SHIP-1 and Grb2. Dok-4- 6 play roles in protein tyrosine kinase(PTK)-mediated signaling in neural cells and Dok-7 is the key cytoplasmic activator of MuSK (Muscle-Specific Protein Tyrosine Kinase). In general, PH domains have diverse functions, but are generally involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
pfam13632	Glyco_trans_2_3	0.002	91	280	2	190	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM71601.1	7.63e-217	1	297	1	297
QTO25124.1	7.63e-217	1	297	1	297
QKH83187.1	7.63e-217	1	297	1	297
AUI46850.1	6.27e-216	1	297	1	297
QCQ37775.1	1.27e-215	1	297	1	297

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.935443	0.064075	0.000135	0.000101	0.000088	0.000182

TMHMM  Annotations     

start	end
10	32
245	267
271	293