CAZyme Information: MGYG000000236_00482

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_00482
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1020	MGYG000000236_2|CGC7	115744.6	7.1586

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 149458; End: 152520 Strand: +

Full Sequence      

MNKPIKLTFLLLLACLVMVPAKAQKTPEWQSQYAVGLNKLAPHTYVWPYADAADVKKGDY
EQSPYYLSLNGKWKFHWVKNPDLRPKDFYKPSFYTGGWADINVPGNWERQGYGTAIYVNE
TYEFDDKMFNFKKNPPLVPSEENEVGSYRRTFTVPSGWKDRRVVLCCEGVTSFYYVWVNG
HFLGYNQGSKTAAEWDITDKLEEGENTVALEVYRWSSGSYLECQDMWRLSGIERDVYLYS
TPKQYIADYKVNATLEKERYKDGIFGLDVTVEGPANGAVSITYTLNDAAGRPVLSGEMPV
KSRGLSNFITFGEQRLKDVKPWSAEHPNLYTLVLELKNAGGRVTEVTGCEVGFRTSEIKD
GRFCINGVPVLVKGTNRHEHSQLGRTVSKELMEQDIRLMKLHNINTVRNSHYPTHPYWYQ
LCDRYGLYMIDEANIESHGMGYGPASLAKDSTWLTAHMDRTHRMYERSKNHPAIVIWSLG
NEAGNGINFERTYDWLKSVEKNRPVQYERAEQNYNTDIYCRMYRSVDEIKTYLAQKDIYR
PFILCEYVHAMGNSVGGLKEYWDVFENNPMAQGGCVWDWVDQSFREIDANGRWYWSYGGD
YGPKGVPSFGNFCCNGLVSADRVPHPHLLEVKKIYQNIKCTLLYKSNLTIRVKNWFDFSN
LNEYILHWQVVGDNGQTVTEGTKEVNCAPHATVDVTLGKVVLPANVREGYLNLSWTRKEA
SLMVGTDWEVAYDQFVLPGTKNSTAHLPAKAGQTAFTLDKATGALNSFTLDGQELLATPV
TLSLFRPATDNDNRDRNGAYLWRKSGLDQLSQKVVSLKESKSTATARVEVLNAKGTKVGD
ADFIYSLNAAGALKVKVTFRPDTAVVKSMARLGLAFEMNDTFGNVAYLGRGDNETYADRM
QSGKIGLYRTTAERMFHYYVTPQSTGNRTDVRWMKLEDEAGQGIFVDSNRPFQFSVVPFT
DDVLEKARHINDLERNGRITVHLDAEQAGVGTATCGPGVQPQYRVPLTEQSFEFTLRGVK

Enzyme Prediction     

No EC number prediction in MGYG000000236_00482.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	58	903	1.7e-216	0.9680851063829787

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	29	1017	17	1025	beta-galactosidase.
PRK10340	ebgA	0.0	29	1016	4	997	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	9.43e-158	68	906	14	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
smart01038	Bgal_small_N	3.08e-101	750	1016	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.
pfam02836	Glyco_hydro_2_C	1.12e-100	357	639	2	301	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM72067.1	0.0	1	1020	1	1020
QCQ46927.1	0.0	1	1020	1	1020
QTO25519.1	0.0	1	1020	1	1020
QLK84296.1	0.0	1	1020	1	1020
QCQ56065.1	0.0	1	1020	1	1020

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DEC_A	0.0	27	1020	5	998	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	0.0	24	1020	5	1002	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6S6Z_A	1.57e-229	28	1017	3	978	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.62e-229	28	1017	4	979	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
1JZ7_A	6.90e-176	28	1005	15	1009	E.COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	8.86e-229	28	1017	4	979	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	1.43e-219	21	991	12	1004	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q6LL68	5.61e-181	28	1016	11	1023	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
A3FEW8	7.46e-181	28	1017	17	1026	Beta-galactosidase OS=Enterobacter agglomerans OX=549 GN=lacZ PE=1 SV=2
P81650	1.42e-180	28	1018	12	1035	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000534	0.997941	0.000853	0.000240	0.000210	0.000196

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_00482.