CAZyme Information: MGYG000000236_00835

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_00835
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
299	MGYG000000236_3|CGC9	35998.74	10.2089

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 275856; End: 276755 Strand: +

Full Sequence      

MMFFKRTFKKTYQNQRMMKLVRMTGGLGNQMFIYAFYIQMKTIFPELRIDMSEMKKYKLH
NGYELEDVFSIRPQTISAHKWLKRVIVYAFFSIIREKSEEELSIHKYTQHKRWPLVYYKG
FFQSELFFKESSDTIRDIFSFNTENANFRTKEWAKIIKEQRSSVSIHIRRGDYTSAKNKI
KYGNICTEEYYQKAISIILKKEPKAFFHIFSDDVEWTKAHLKVHHLPHQYISWNKGPDSW
QDMMLMSLCRHNIIANSSFSWWGAWLNAYKDKTVIAPSRWSNVKKTPHILPESWISIDI

Enzyme Prediction     

No EC number prediction in MGYG000000236_00835.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	20	297	2.3e-70	0.9891304347826086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	1.10e-64	18	285	1	260	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.53e-26	16	297	30	297	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ35387.1	1.10e-226	1	299	1	299
QRM69288.1	1.10e-226	1	299	1	299
AUI48672.1	1.56e-226	1	299	1	299
QCQ53240.1	3.14e-226	1	299	1	299
QTO27833.1	6.11e-226	2	299	1	298

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	3.65e-32	23	297	5	302	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866E8	4.06e-08	100	298	143	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Sapajus apella OX=9515 GN=FUT1 PE=3 SV=1
Q866F0	4.06e-08	100	298	143	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri boliviensis boliviensis OX=39432 GN=FUT1 PE=3 SV=1
Q866F1	4.06e-08	100	298	143	354	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Saimiri sciureus OX=9521 GN=FUT1 PE=3 SV=1
P19526	7.27e-08	101	298	143	353	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Homo sapiens OX=9606 GN=FUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000027	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	38