CAZyme Information: MGYG000000236_01233

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_01233
• CAZy Family: CBM9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
687	MGYG000000236_5|CGC3	79886.68	5.9733

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 148109; End: 150172 Strand: +

Full Sequence      

MKQIHLDCLAVKLFLFFSLFSLPSGAQSIFQKYDRFLTEPRSYVCYRVDGKLKIDGKLDE
VSWQKAKSTAPFVDISGEGYPTPKYETTAKMLWDDEYLYVGAILQEDDIKARLTQRDTII
YYDNDFEVFIDPDWDGHNYFEIETNARGVIFDLMLDKPYRSGGNFMVQWDCPGLKLAIHR
EGTLNKSKDKDKYWSVEMAIPHKALTMNFNNPLKAGNCWRINFSRVQWLKAGGPEENWVW
TPTGKVDMHMPDRWGYLFFADEAVGAPERTVALPYNTAVYKLLWAMFYAQQERYAKEKSY
LRTEKDFFLTDAELKGLPQGAQISVDATRNTYQIAITVPGENKRYVINNEGRFWTEKIAP
RQVKNWVWTRINKNKSEADYRQWFALLKECGISGVMFEGYDENLYRMCKEAGLEAHFWKW
TMNRAELLNVHPDWFAVNRKGESTHDKPAYVDYYRFLCPNHEGVAQYLADDYVKIAHLPY
VDGVHLDYVRFPDVVLPVSLWKNYGIEQTSEHPEYDYCYCEVCRAKFKAQTGRDSLELKY
PMEDQSWINFRLDAITRVVDRITEAVKADGKAISAAVFPGPSMAKKMVRQDWGNWTLDAY
FPMIYNGFYYEGPEWIGRSVQESVKTVDGRAKVYAGLMFPDIKNDFEKALDEAFDNGASG
VSFFDGPSDEYLHKFKAYLDKKGLKTE

Enzyme Prediction     

No EC number prediction in MGYG000000236_01233.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM9	54	257	1.2e-42	0.9835164835164835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09620	CBM9_like_3	1.16e-74	54	256	1	200	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily may co-occur with various other domains.
cd09618	CBM9_like_2	8.94e-30	42	226	1	170	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized subfamily are typically found at the N-terminus of longer proteins that lack additional annotation with domain footprints.
COG1649	YddW	5.48e-13	399	637	113	339	Uncharacterized lipoprotein YddW, UPF0748 family [Function unknown].
pfam06452	CBM9_1	1.45e-09	54	255	1	177	Carbohydrate family 9 binding domain-like. CBM9_1 is a C-terminal domain on bacterial xylanase proteins, and it is tandemly repeated in a number of family-members. The CBM9 module binds to amorphous and crystalline cellulose and a range of soluble di- and monosaccharides as well as to cello- and xylo- oligomers of different degrees of polymerization. Comparison of the glucose and cellobiose complexes during crystallisation reveals surprising differences in binding of these two substrates by CBM9-2. Cellobiose was found to bind in a distinct orientation from glucose, while still maintaining optimal stacking and electrostatic interactions with the reducing end sugar.
cd09619	CBM9_like_4	1.09e-07	54	150	4	99	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM70728.1	0.0	1	687	1	687
QCQ54751.1	0.0	1	687	1	687
QTO24490.1	0.0	1	687	1	687
QCQ32632.1	0.0	1	687	1	687
QCQ45719.1	0.0	1	687	1	687

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38535	4.60e-06	34	152	702	810	Exoglucanase XynX OS=Acetivibrio thermocellus OX=1515 GN=xynX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000911	0.997902	0.000645	0.000182	0.000169	0.000168

TMHMM  Annotations     

start	end
13	30