CAZyme Information: MGYG000000236_02921

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_02921
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	MGYG000000236_16|CGC1	58824.19	9.5493

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 8604; End: 10157 Strand: +

Full Sequence      

MKSKFLPFLLLLAVLPVLIFRDYTPSNELRYLSIVDEALRNGDIFTFTNHGVQYADKPPL
YFWILMLGKWLLGSHAMWFASLFSFIPALVIMLVMDRWVERETSAANRLSAQLMLMSCGL
FLGLAVVLRMDMLMCMFIVLALRTFYRMLKGQGSKNRNAFLFPFYIFMAVFSKGPVGILV
PLLSTFVFLLITGRVKTFGRYWGWKTFAVLLLGCFIWFGGVCWEEGGLNYLHDLLFRQTV
GRAVNAFDHSAPFYYYFISVWYSLAPWALLLIGVIVAGACRRLIRSDLERFFMVIILSTL
LMLSCFSGKLAVYLAPTFPFFVYLAVLLLSHFRWNQWLALTLVLPAVVFVAGLPALIVLG
RMPGTEFLGQKLFYVAGGVLTVSGCAALYFLYRKKSLNKTINTLAFGLFCAIFVGGWDVP
TINSELGYSELCRKAVELSKEKGTSGYCVLNVRRPENMDVYLHEGVKEVTEEEVLDNKCQ
NTILMISNKKIRSNKELQKFVDGKEHYVIGRFSVMVL

Enzyme Prediction     

No EC number prediction in MGYG000000236_02921.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	472	1.3e-70	0.8703703703703703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.10e-22	20	431	27	443	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.93e-13	28	360	33	367	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	9.10e-07	56	212	1	152	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO25703.1	0.0	1	517	1	517
QLK84536.1	0.0	1	517	1	517
QKH86812.1	0.0	1	517	1	517
QUU03965.1	0.0	1	517	1	517
QRP88934.1	0.0	1	517	1	517

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7UFR9	1.05e-11	27	318	31	320	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=arnT PE=3 SV=1
Q0TFI5	1.32e-10	27	318	31	320	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) OX=362663 GN=arnT PE=3 SV=1
Q8FFL9	1.32e-10	27	318	31	320	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=arnT PE=3 SV=1
B7MXT9	1.74e-10	27	318	31	320	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O81 (strain ED1a) OX=585397 GN=arnT PE=3 SV=1
B1IXT0	1.74e-10	27	318	31	320	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) OX=481805 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.463048	0.534053	0.001107	0.000506	0.000494	0.000777

TMHMM  Annotations     

start	end
5	24
77	99
120	142
166	188
201	223
253	275
288	306
310	332
337	359
372	391
404	421