CAZyme Information: MGYG000000236_02974

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_02974
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836		94182.46	6.9824

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 70510; End: 73020 Strand: -

Full Sequence      

MKRNYWLLAIVFLLSTLHAQAGEWIRINQLGYLPQSKKVAVFMSEVPVEVNNYSLVDVFT
GKTVRTFTSPRKTGPIGQMKSTYRLDFSTFDTPGTYYLKAGKAVSPHFPINHRVYNGTAD
FLLNYMRQQRCGYNPFLKDSCHVHDGFIVYHPTKTGQHTDVRGGWHDATDYLQYTTTSAN
AIYQMMFAYLQNPEAFGDAYDAAGHPGANGIPDIVDEIKWGLDWLNRMNPAQGELYNQIA
DDRDHAGMRLPGKDSVDYGYGRGQGRPVYFCSGEPQVRGKFKNATTGVASTAGKFASCFA
LGAKVLKDFYPDFAQEIASKADNAYQEGIKKPGPCQTASVKSPYIYEEDNWVDDMELGAM
ELFKATGDPKYLEQAVEYGRREPVTPWMGADSARHYQWYPFMNMGHYWVAKASGNERLRD
EFIRNLRTGIQRTYEKAVGSPFLHGIPYIWCSNNLTTAMLTQCRLYRELTGDTTYEEMEA
SLRDWLLGCNPWGTSMIVELPLSGDYPIQPHSSLLNAGVGNTTGGLVDGPVYRTIFESLR
GVNMEGIPGMPGQDYERFQPDLMVYHDALHDYSTNEPTMDGTACLTYYLSSLQKDGMKQA
NAAADKNIYSNGGIVRTDPSKKQITLVFTAADRADGADAIISTLKKQGIKGAFFFTGEFY
ELYPDVVQRLLKEGHYVGSHSYGHLLYSPWGNRDSLLVTREEFEKDLLKSYEVMRKAGIE
FKDAPLYIPPYEYYNRQIAAWAKNMGIQVVNFTAGTASNADYTTPDMKNYRSSQAIYDKI
LSVEAAEGLNGHLMLIHFGTDARRTDKFYKGHLERLIKVLKNKGYKFVPLREAVGI

Enzyme Prediction     

No EC number prediction in MGYG000000236_02974.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	115	589	7.3e-77	0.992822966507177
CE4	618	751	4.9e-18	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	3.47e-64	123	589	7	374	Glycosyl hydrolase family 9.
cd10917	CE4_NodB_like_6s_7s	1.26e-27	640	821	19	171	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
pfam02927	CelD_N	4.95e-25	24	105	2	83	Cellulase N-terminal ig-like domain.
cd02850	E_set_Cellulase_N	1.59e-24	24	110	1	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd10949	CE4_BsPdaB_like	5.37e-24	620	832	2	188	Putative catalytic NodB homology domain of Bacillus subtilis putative polysaccharide deacetylase PdaB, and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by the putative polysaccharide deacetylase PdaB encoded by the pdaB gene on sporulation of Bacillus subtilis. Although its biochemical properties remain to be determined, the PdaB (YbaN) protein is essential for maintaining spores after the late stage of sporulation and is highly conserved in spore-forming bacteria. The glycans of the spore cortex may be candidate PdaB substrates. Based on sequence similarity, the family members are classified as carbohydrate esterase 4 (CE4) superfamily members. However, the classical His-His-Asp zinc-binding motif of CE4 esterases is missing in this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ56204.1	0.0	1	836	1	836
QRM72252.1	0.0	1	836	1	836
QCQ33880.1	0.0	1	836	1	836
QKH86859.1	0.0	1	836	1	836
QLK84487.1	0.0	1	836	1	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	1.67e-38	22	587	15	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U2O_A	2.62e-27	33	612	2	553	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
5U0H_A	5.78e-24	33	612	2	553	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
4CJ0_A	2.78e-22	20	618	25	572	ChainA, ENDOGLUCANASE D [Acetivibrio thermocellus],4CJ1_A Chain A, ENDOGLUCANASE D [Acetivibrio thermocellus]
1CLC_A	2.92e-22	20	618	39	586	ChainA, ENDOGLUCANASE CELD; EC: 3.2.1.4 [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DDN1	7.13e-22	20	611	49	585	Endoglucanase D OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celD PE=1 SV=1
P0C2S4	1.52e-21	20	618	25	572	Endoglucanase D (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celD PE=1 SV=1
P23658	2.95e-18	25	592	4	545	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1
A7LXT3	4.52e-18	22	592	29	578	Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02649 PE=1 SV=1
P50865	4.58e-18	614	835	49	244	Probable polysaccharide deacetylase PdaB OS=Bacillus subtilis (strain 168) OX=224308 GN=pdaB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.998977	0.000229	0.000152	0.000144	0.000142

TMHMM  Annotations     

start	end
5	22