CAZyme Information: MGYG000000236_03294

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_03294
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000000236_19|CGC5	34817.79	4.1926

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 94954; End: 95907 Strand: -

Full Sequence      

MKQNILKAAILAAGFCCTVGCSDNDSDLTIYIPDARTAVKANFYIEDEPYVQTFNVAVTP
ETYPQLTEYGLPNDAVVHLQADPDKVNEYNTKNGTEYELLPEAAYDLTGEVLVKAGTSKS
EEAVITVHAKGNIEAFKEYLLPVSITSVEGAVADDCCQTIYFIFRGSMDASNMELLDRTG
WEALSASSEEPKEGDWGHSGLKEACLDGDLNTFWGTDWSNQHPQPPHWIVIDLKKTTHIQ
GFACQAREEGYDGPKEVTVEVSEDNATWTVAAKFKDIPAQGEFRSFLPDAVDGRYLKVTI
TAVNGGPHVTVSELNLF

Enzyme Prediction     

No EC number prediction in MGYG000000236_03294.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	187	314	7.1e-20	0.9435483870967742

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08522	DUF1735	9.80e-20	29	152	4	120	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam00754	F5_F8_type_C	2.02e-16	185	306	1	118	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	9.57e-07	182	307	12	135	Substituted updates: Jan 31, 2002
smart00231	FA58C	1.74e-05	173	307	3	130	Coagulation factor 5/8 C-terminal domain, discoidin domain. Cell surface-attached carbohydrate-binding domain, present in eukaryotes and assumed to have horizontally transferred to eubacterial genomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM69709.1	7.25e-241	1	317	1	317
QCQ53710.1	8.47e-240	1	317	1	317
QTO27246.1	3.45e-239	1	317	1	317
QCQ44749.1	4.90e-239	1	317	1	317
QCQ35820.1	4.90e-239	1	317	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3F2Z_A	1.13e-10	176	316	5	145	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]
1GOF_A	3.94e-09	176	317	9	146	NOVELTHIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOG_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],1GOH_A NOVEL THIOETHER BOND REVEALED BY A 1.7 ANGSTROMS CRYSTAL STRUCTURE OF GALACTOSE OXIDASE [Hypomyces rosellus],2EIE_A Chain A, Galactose oxidase [Fusarium graminearum],2JKX_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ1_A Chain A, GALACTOSE OXIDASE [Fusarium graminearum],2VZ3_A Chain A, Galactose Oxidase [Fusarium graminearum]
1T2X_A	3.94e-09	176	317	9	146	Glactoseoxidase C383S mutant identified by directed evolution [Fusarium sp.]
2EIB_A	3.94e-09	176	317	9	146	ChainA, Galactose oxidase [Fusarium graminearum]
2EIC_A	3.94e-09	176	317	9	146	ChainA, Galactose oxidase [Fusarium graminearum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0CS93	2.21e-08	176	317	50	187	Galactose oxidase OS=Gibberella zeae OX=5518 GN=GAOA PE=1 SV=1
I1S2N3	2.95e-08	176	317	50	187	Galactose oxidase OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GAOA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000032	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_03294.