CAZyme Information: MGYG000000236_03692

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_03692
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
927	MGYG000000236_24|CGC1	105977.71	5.9766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 27317; End: 30100 Strand: -

Full Sequence      

MKQPSKNWLLCVLLGMIVCSSATAQKLPEKQFFHPDRVRYDKDCFTIEGKDIFILSAAFH
YFRCPQELWRDRFRKIKEAGFNTVETYVPWNWHERNMPKNVDDYSQFDFDDLKAWLRMAH
EEFGFYTIVRPGPFICAEWAGGAYPRWLAKYCPDSYDTSFWLRSNHPEHMKWSEHWYNAV
CRVFCDEQLTHKKPGEKGIIMVQLENEYIYFDMESEKKEEFLRVLSDACIRNGIDVPLFT
CVTPEVRGSHDPVISQLFDMDNQYVWWNMHEAKSRIENLKAEQPNAPAFVCELQGGWFST
VGGRLSEDSYLDGRHARGMALMAMAGGSTGLNYYMFFGGTHFDGWGARRMTTTYDYGAPL
KETGGVGEKYAAVKGIGEVVGKFGSRLVRSKSVPFEMKGNDNLTMGVRRATDGTLFIFLL
NRDKKQEFRQIVSLTIEGKPMRIDCRLGALDSKLLVLSPGGTSTEWYPREQVLPARPVAL
PAAISVTKVWRKDEDFRGDWKPLRKGVSLPELGVNDCRYSMYRSRVNLTQKEVDLYGSLV
FELFTGDPVYVQVNGKFAERVSRDELDNTFIVSGLLHKGMNEVVAIYENRGHAHGYRPME
ELSGLRQAGFGRKQTGILPVEEWEVRTIDKEEPLSALLAEETGWERMRLDQRTIDDLATL
QIAGLEKPEWPAAWILQEKAGSAVYRTHLRWTPEMIREGMTVLEFGCIDDAGTLWVNGKE
VGTHEEWDKPYVVNVAPFVKPGDNEIAIVVSNQSGAGGLLKAVRLKQEFEVIKKINWEVS
ADLGGICQGWNREPDSTEGWSVAELPADYPLVRKGRITETLEAGVGRDALLTWYRLEFDM
PRNDPSVRIPWKLIVNATGTGYMWLNGHNIGRHWEEGPQREFYLPECWLRPGEKNVIVLG
LRQSENKGARLFGAEVAPYVEDAECIQ

Enzyme Prediction     

No EC number prediction in MGYG000000236_03692.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	45	376	3.7e-95	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	4.65e-72	45	374	2	312	Glycosyl hydrolases family 35.
PLN03059	PLN03059	1.01e-33	38	364	30	325	beta-galactosidase; Provisional
COG1874	GanA	3.02e-22	38	208	1	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	5.67e-06	639	754	19	137	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02449	Glyco_hydro_42	1.43e-05	65	208	8	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ49125.1	0.0	1	927	1	927
QRM69631.1	0.0	1	927	1	927
QCQ31300.1	0.0	1	927	1	927
QCQ35733.1	0.0	1	927	1	927
QTO27114.1	0.0	1	927	1	927

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	2.67e-38	37	378	17	337	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3THC_A	6.24e-36	38	376	11	330	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	7.51e-36	38	376	35	354	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	1.77e-35	38	376	35	354	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
6EON_A	1.70e-34	1	376	1	345	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5R7P4	2.31e-37	9	376	8	353	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
Q60HF6	5.69e-36	9	376	8	353	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
P16278	2.30e-35	9	376	8	353	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q58D55	6.03e-35	3	376	1	352	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1
O19015	6.83e-35	1	383	1	358	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000270	0.999065	0.000231	0.000151	0.000132	0.000127

TMHMM  Annotations     

start	end
7	24