CAZyme Information: MGYG000000236_04002

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_04002
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
283	MGYG000000236_29|CGC2	33294.19	8.4341

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 51342; End: 52193 Strand: -

Full Sequence      

MKIVQIIGGLGNQMFQFAFYLALKEKYVNVKLDTSSFGAYTHNGFELDKVFHVEYLKASI
RERIKLSYQGSEIWIRVLRKLLKRKKTEYVEPYLCFDENAISLSCDKYYIGYWQSYKYFT
NIEAAIRGQFHFSKVLSDKNEFIKKQMQNSNSVSLHVRLGDYVNNPAYSNICTSAYYNKA
INIIQSKVSEPKFFVFSDDTVWCKDHLKIPNCHIIDWNNKEESYWDMCLMTYCKHNIIAN
SSFSWWGAWLNTNPERIVIAPGKWINDDRVQVSDIIPSDWICV

Enzyme Prediction     

No EC number prediction in MGYG000000236_04002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	2	281	6.6e-77	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	2.03e-72	1	278	1	265	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	9.14e-26	108	281	125	295	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.
TIGR01612	235kDa-fam	0.008	21	192	603	792	reticulocyte binding/rhoptry protein. This model represents a group of paralogous families in plasmodium species alternately annotated as reticulocyte binding protein, 235-kDa family protein and rhoptry protein. Rhoptry protein is localized on the cell surface and is extremely large (although apparently lacking in repeat structure) and is important for the process of invasion of the RBCs by the parasite. These proteins are found in P. falciparum, P. vivax and P. yoelii.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT75971.1	2.11e-216	1	283	1	283
QRM68592.1	2.11e-216	1	283	1	283
CAH09369.1	2.63e-216	1	283	7	289
QLK80744.1	8.58e-216	1	283	1	283
QCQ48037.1	8.58e-216	1	283	1	283

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	2.44e-32	8	281	7	300	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_04002.