CAZyme Information: MGYG000000236_04071

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_04071
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
995	MGYG000000236_31|CGC1	110272.42	8.2652

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 17737; End: 20724 Strand: +

Full Sequence      

MLKQLLTAALLLGAGALWAQQTAGLLPVREDVHCNEWVEQTLSRMKLKDKVGQLFVYTLA
PRTDKDTEKLVDKLTRKLKVGAFLYSEGTVEGQAKLTNRAQSRSKIPLMITFDGEWGLSM
RLENTPVFPRNAALGCISDNALIEAYGQEVAREFREMGVHVNFAPDADVNTNPDNPVIHV
RSFGENPEAVAEKVIAYGRGLESGGILSVSKHFPGHGDTDVDSHKALPAVYYNRARLDSV
ELYPFKQAIRAGLGGIMVGHLQVPALEPDRITPSSLSRSIVTDVLRGELGFNGLVFTDAL
AMKGVASEPDVTVKALKAGNDMVLVQQNIEKAQQDVLQAIKEGRLSMEEVNAKCRRILTY
KYRLGLNKRPVISVDGLSDRISTPEARALLTKLRTSAVTVLGNYFRILPLVTKDEIAVLT
VGGEGSDALFIEELRTRLSLKTFRMDKDTGEEERKRIAKELGKHRRVIVSMTIKDKEAEE
YRPFFTDLNLQAPVVYAFFTSYRTLVTLEEAVARSAAVVLAHSDEADLQRYVADVVLGKA
SATGRLSMRIGETFAAGSGVDIVPGMTAGTAPEDYGLKSYRLHRIDSVVSAGLAAKAFPG
CQVLVLRHGQPVYDKCFGIHSDTDSTPVRPTDLFDLASLTKTSATLLAVMKLYDQGQLKL
TDPASKYLPALRNTNKKNITIRELLLHESGLVPYIRFYRNAIDEYSVTGPFTQGFVDEWH
HTRMGEYTYACSDFKFRRGLVSATKTPEHTLKIADGMWLHRKFKAAMMKSIVQSELDRKR
FVYSDIGFILLQQVVESITGQTLDAYLAAEFYRPMGLERTLFQPLNCYKKTEVMPTATND
YLRRQNLCGYVHDEAAAFMGGVSGNAGLFSTACELGKIYQMILNEGELDGKRYLRSETCR
AFTMGKSAVSHRGLGYDKPNLNDPKANACAPSAPASVYGHTGFTGTCAWVDPENDLVYIF
LSNRLCPDSWNGKLNSMKIRQGIQEVIYQSLYTTE

Enzyme Prediction     

No EC number prediction in MGYG000000236_04071.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	100	325	6.5e-62	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.12e-81	45	427	1	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.16e-78	47	359	2	315	Glycosyl hydrolase family 3 N terminal domain.
PRK03642	PRK03642	1.08e-50	571	964	29	395	putative periplasmic esterase; Provisional
pfam00144	Beta-lactamase	1.27e-44	585	965	1	309	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
COG1680	AmpC	5.23e-41	545	969	1	368	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM69575.1	0.0	1	995	1	995
AUI48961.1	0.0	1	995	1	995
QCQ49069.1	0.0	1	995	1	995
QCQ35677.1	0.0	1	995	1	995
QTO27058.1	0.0	1	995	1	995

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	3.07e-61	45	429	11	407	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	8.87e-60	40	433	37	470	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	2.58e-59	40	433	11	444	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	4.58e-59	40	433	41	474	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
3SQL_A	1.11e-50	80	387	58	369	CrystalStructure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQL_B Crystal Structure of Glycoside Hydrolase from Synechococcus [Synechococcus sp. PCC 7002],3SQM_A Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_B Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_C Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002],3SQM_D Crystal Structure of Glycoside Hydrolase from Synechococcus Complexed with N-acetyl-D-glucosamine [Synechococcus sp. PCC 7002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	4.86e-59	40	433	37	470	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	2.74e-48	81	410	66	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P77619	2.95e-42	570	964	28	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli (strain K12) OX=83333 GN=yfeW PE=1 SV=2
Q8XBJ0	1.81e-41	570	964	28	395	Putative D-alanyl-D-alanine carboxypeptidase OS=Escherichia coli O157:H7 OX=83334 GN=yfeW PE=3 SV=1
Q7WUL3	2.26e-40	37	410	18	398	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000319	0.999021	0.000167	0.000171	0.000152	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_04071.