CAZyme Information: MGYG000000236_04128

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_04128
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		43021.3	6.3105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 39920; End: 41035 Strand: +

Full Sequence      

MKRIGIYIATVVCILSCVPPQRNLLTETRQMLVDSGATERTAALFYNLRQLTGKQVVYGQ
HNYEMDGFDSDTTRWRDEANRCDAYDVTGTYPALASFDFLHFTNPRSWETKDPDYIRQKF
HAAYNRGNVITFCWHYYNPVTGGNFYDTTRVVRHILPGGSHHAIFKADLKIIADFAHNAK
ADNGELIPIIFRPWHEFDGNWFWWGRNHCRVEEFKELYRFTVTYLRDSLQVHNFLYAFSP
DCGFTTEAEYLERYPGDEYVDVVGMDNYSDFRPDGGDTSLVVLKARILTQYARRHAKLSA
ITETGTQTRDSLWYTQLLSILRSEGVALNYVCSWSGFAPYKGHPAATDFCRFKEDSLVLF
ADEIPDFYTWP

Enzyme Prediction     

No EC number prediction in MGYG000000236_04128.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	33	337	8e-69	0.9075907590759076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.39e-36	33	268	1	230	Glycosyl hydrolase family 26.
COG4124	ManB2	5.90e-17	158	278	157	266	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM69805.1	5.09e-291	1	371	1	371
QTO27336.1	8.45e-290	1	371	1	371
AUI45334.1	1.40e-288	1	371	1	371
QCQ49302.1	5.71e-288	1	371	1	371
QCQ53806.1	5.71e-288	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q78_A	1.51e-82	27	371	52	415	Thestructure of GH26C from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q78_B The structure of GH26C from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
2VX4_A	5.36e-74	20	368	21	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	5.36e-74	20	368	21	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	1.01e-73	20	368	44	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	4.21e-73	20	368	21	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1A278	5.72e-54	34	363	44	397	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49424	5.78e-53	32	324	49	348	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
P49425	8.57e-19	32	370	146	463	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55278	5.04e-15	70	335	65	343	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
O05512	3.07e-14	187	335	184	325	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000027	1.000027	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_04128.