CAZyme Information: MGYG000000236_04135

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_04135
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000000236_32|CGC3	42444.91	5.9625

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 48748; End: 49872 Strand: +

Full Sequence      

MIKRIKILATGALLMAGLGACYPSGKKTGSETVADTLRTAETVNLLNNLRQIPGQGFMFG
HHDDPLYGVGWEGDEGRSDVKSVCGDYPAVMSFDLGHIELEGEKSLDNVQFRKIRQETIN
QYKRGGMVSFSWHLDNPSTGKDAWDVSDTTVVASILPGGTHHTKFVGWLDAVAAFMNTLE
TEDGTKIPVLFRPWHEHTGSWFWWGQNLCTAEQYKALWRMTYERMHAKGVKNLLYAYSPG
SEPKDSAAYLERYPGDDIIDLVGFDTYQFDRTQYMEQLDKSLAILTEVGQSHNKPIAITE
TGFEAIPDSTWWTQTLYPVISKYPISYVLVWRNARERVNHYYAPYPGQVSADDFVKFYRE
PKTLFVSDVKDLYK

Enzyme Prediction     

EC	3.2.1.-	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	38	333	4.8e-68	0.8910891089108911

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	3.85e-41	39	267	6	230	Glycosyl hydrolase family 26.
COG4124	ManB2	7.73e-19	136	344	123	352	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM69812.1	1.03e-287	1	374	1	374
QCQ35926.1	1.03e-287	1	374	1	374
QCQ44849.1	1.03e-287	1	374	1	374
QLK82239.1	1.03e-287	1	374	1	374
QKH85000.1	5.94e-287	1	374	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	3.31e-174	38	374	8	344	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	5.57e-84	24	374	23	396	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	1.08e-83	24	374	46	419	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX5_A	1.11e-83	24	373	23	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX7_A	4.42e-83	24	374	23	396	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	9.54e-57	9	374	17	416	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	6.55e-44	6	367	7	396	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49425	7.18e-22	80	313	189	424	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55278	1.60e-21	1	331	1	322	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
P16699	2.04e-21	44	333	52	330	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000077	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_04135.