CAZyme Information: MGYG000000236_04309

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_04309
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
568	MGYG000000236_36|CGC1	63437.96	8.0689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 34376; End: 36082 Strand: -

Full Sequence      

MMKRLSTLCLLAAGFFLPGQAQQARPLVLDSVCAPLKVATPPSDAYIGLSLLDNGEVRHY
NYGEQAVAGAVYLSSTDHGLTWKRVNRAKEMPFADRQSPVSKEYIRLVDMGAMGVYCIRT
SGGLAGGRTLTKVADRSSIMIKPPVFIRNGKRIVVAAHGGVTPKGCYTYVSDDDGLTWKC
SNTVTSPDHRGGGFHKGIRWNHGAVEPTVVELKDGTLWMLMRTSQDRHYQAFSQDGGLTW
SESEPSPFYGTITMPTLGRLADGRLLLFWCNTTPLPEKEGTNGVWDDVFTNRDVTHVAVS
DDDGKTWTGFRELYMDPMRNDSDYAVNGGGIDRGVHQAQFVEVAPGKVLASIGQHPLHRA
MMMFDVNWLYEKSRFNNFSDSLSQWSTFNYIDGIKGHCAYNRIQGCRLESHPEKEGCQVL
HLSYQPDASLVADTRGAVWNFPAMKKGTFTVSLRIPEGSHSVSLLLNDRWMNPSDTVARY
ESMYELPLTRKQLGVKDDRWHEVSLEWDLSQKRPQARVRVDGRLRSLRLPLRNKSQNGIS
YVHFIAPPAEANPGIYLEWVRAEADGTI

Enzyme Prediction     

No EC number prediction in MGYG000000236_04309.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	65	314	2.9e-25	0.5497076023391813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.57e-25	147	317	153	303	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	9.29e-17	143	307	115	251	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	5.66e-09	171	352	52	216	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	5.85e-06	167	308	21	151	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	6.52e-06	117	308	19	199	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM72816.1	0.0	2	568	1	567
QCQ47658.1	0.0	2	568	1	567
QLK85135.1	0.0	2	568	1	567
QCQ52211.1	0.0	2	568	1	567
AUI49199.1	0.0	2	568	1	567

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999034	0.000217	0.000179	0.000159	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_04309.