CAZyme Information: MGYG000000236_04324

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_04324
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000000236_37|CGC1	40910.79	8.1006

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 9531; End: 10631 Strand: -

Full Sequence      

MKNTILKLFLLFCAVPSIGQNVHPNLPWIDISGQRERQVTIAPGRPDLYNGHPTTVMMDD
HKTILCTWSYGHGGKASFIAESKDAGLTWKNGKTPADWQTMSNCPSIYKLTDKQGKERVF
VFSAWPDMPMTYSEDGGKSWSPVRSLNKPCVMAFSSIVKLKNGDYLGLYHRGLNDRDRPP
LTLWQSVSHDGGLTWSESVKVGEMEGRSPCEPCVFRAPDGKRLVCVARENNRVGNSLMMF
SDDEGTTWSPLQETPWGLTGDRHVIKFTPDGRMIAVFRDMAPNSPTKGHFVAWVGNYKDL
LEGTSGQYKIKLLHSYAGSDCGYPGLEILPDGTIVAITYVKMRPGPEQHSIVGVRFKLEE
TDKMLY

Enzyme Prediction     

No EC number prediction in MGYG000000236_04324.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	6.13e-29	82	356	52	338	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	3.81e-12	133	334	87	278	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	1.45e-10	37	221	98	277	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	8.58e-09	155	291	17	176	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	4.15e-07	52	169	201	322	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDU73633.1	2.89e-113	26	364	204	544
QDV35524.1	1.85e-87	25	364	38	381
AQW27075.1	1.38e-58	25	365	198	567
ATD48363.1	1.38e-58	25	365	198	567
ABG82852.1	2.68e-58	25	365	198	567

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000219	0.999161	0.000153	0.000154	0.000134	0.000127

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_04324.